RUN: /usr/share/launchpad-buildd/slavebin/slave-prep Forking launchpad-buildd slave process... Kernel version: Linux bos01-ppc64el-013 4.4.0-97-generic #120-Ubuntu SMP Tue Sep 19 17:26:02 UTC 2017 ppc64le Buildd toolchain package versions: launchpad-buildd_154 python-lpbuildd_154 sbuild_0.67.0-2ubuntu7.1 bzr-builder_0.7.3+bzr174~ppa13~ubuntu14.10.1 bzr_2.7.0-2ubuntu3.1 git-build-recipe_0.3.4~git201611291343.dcee459~ubuntu16.04.1 git_1:2.7.4-0ubuntu1.3 dpkg-dev_1.18.4ubuntu1.2 python-debian_0.1.27ubuntu2. Syncing the system clock with the buildd NTP service... 1 Nov 17:15:29 ntpdate[1738]: adjust time server 10.211.37.1 offset 0.058418 sec RUN: /usr/share/launchpad-buildd/slavebin/in-target unpack-chroot --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 /home/buildd/filecache-default/64ab4a3b1843816d631a3747c16f42fa2d8de59d Creating target for build PACKAGEBUILD-13664339 RUN: /usr/share/launchpad-buildd/slavebin/in-target mount-chroot --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 Starting target for build PACKAGEBUILD-13664339 RUN: /usr/share/launchpad-buildd/slavebin/in-target override-sources-list --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 'deb http://ftpmaster.internal/ubuntu bionic main universe' 'deb http://ftpmaster.internal/ubuntu bionic-security main universe' 'deb http://ftpmaster.internal/ubuntu bionic-updates main universe' 'deb http://ftpmaster.internal/ubuntu bionic-proposed main universe' Overriding sources.list in build-PACKAGEBUILD-13664339 RUN: /usr/share/launchpad-buildd/slavebin/in-target update-debian-chroot --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 Updating target for build PACKAGEBUILD-13664339 Get:1 http://ftpmaster.internal/ubuntu bionic InRelease [235 kB] Get:2 http://ftpmaster.internal/ubuntu bionic-security InRelease [65.4 kB] Get:3 http://ftpmaster.internal/ubuntu bionic-updates InRelease [65.4 kB] Get:4 http://ftpmaster.internal/ubuntu bionic-proposed InRelease [85.4 kB] Get:5 http://ftpmaster.internal/ubuntu bionic/main ppc64el Packages [1015 kB] Get:6 http://ftpmaster.internal/ubuntu bionic/main Translation-en [541 kB] Get:7 http://ftpmaster.internal/ubuntu bionic/universe ppc64el Packages [7847 kB] Get:8 http://ftpmaster.internal/ubuntu bionic/universe Translation-en [4790 kB] Get:9 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el Packages [100 kB] Get:10 http://ftpmaster.internal/ubuntu bionic-proposed/main Translation-en [57.4 kB] Get:11 http://ftpmaster.internal/ubuntu bionic-proposed/universe ppc64el Packages [362 kB] Get:12 http://ftpmaster.internal/ubuntu bionic-proposed/universe Translation-en [224 kB] Fetched 15.4 MB in 3s (3987 kB/s) Reading package lists... Reading package lists... Building dependency tree... Reading state information... Calculating upgrade... The following packages were automatically installed and are no longer required: libasn1-8-heimdal libcurl3-gnutls libgssapi-krb5-2 libgssapi3-heimdal libhcrypto4-heimdal libheimbase1-heimdal libheimntlm0-heimdal libhx509-5-heimdal libidn2-0 libk5crypto3 libkeyutils1 libkrb5-26-heimdal libkrb5-3 libkrb5support0 libldap-2.4-2 libldap-common libpsl5 libroken18-heimdal librtmp1 libsasl2-2 libsasl2-modules-db libunistring0 libwind0-heimdal Use 'sudo apt autoremove' to remove them. The following packages will be REMOVED: apt-transport-https* The following NEW packages will be installed: liblsan0 libtsan0 The following packages will be upgraded: apt base-files base-passwd binutils binutils-common binutils-powerpc64le-linux-gnu build-essential coreutils cpp-7 debconf dpkg dpkg-dev e2fslibs e2fsprogs g++-7 gcc-7 gcc-7-base gnupg gnupg-agent gpgv libapt-pkg5.0 libasan4 libatomic1 libbinutils libc-bin libc-dev-bin libc6 libc6-dev libcap-ng0 libcap2 libcc1-0 libcomerr2 libcurl3-gnutls libdpkg-perl libgcc-7-dev libgcc1 libgcrypt20 libgmp10 libgomp1 libgpg-error0 libhogweed4 libitm1 libkeyutils1 libnettle6 libp11-kit0 libpcre3 libperl5.26 libpng16-16 libpsl5 libseccomp2 libselinux1 libsemanage-common libsemanage1 libsqlite3-0 libss2 libstdc++-7-dev libstdc++6 libsystemd0 libubsan0 libudev1 linux-libc-dev multiarch-support perl perl-base perl-modules-5.26 pinentry-curses systemd systemd-sysv tzdata 69 upgraded, 2 newly installed, 1 to remove and 0 not upgraded. Need to get 54.9 MB of archives. After this operation, 8159 kB of additional disk space will be used. Get:1 http://ftpmaster.internal/ubuntu bionic/main ppc64el base-files ppc64el 10ubuntu1 [55.9 kB] Get:2 http://ftpmaster.internal/ubuntu bionic/main ppc64el coreutils ppc64el 8.26-3ubuntu4 [1251 kB] Get:3 http://ftpmaster.internal/ubuntu bionic/main ppc64el dpkg ppc64el 1.19.0.4ubuntu1 [1149 kB] Get:4 http://ftpmaster.internal/ubuntu bionic/main ppc64el libc6-dev ppc64el 2.26-0ubuntu2 [2458 kB] Get:5 http://ftpmaster.internal/ubuntu bionic/main ppc64el libc-dev-bin ppc64el 2.26-0ubuntu2 [65.4 kB] Get:6 http://ftpmaster.internal/ubuntu bionic/main ppc64el linux-libc-dev ppc64el 4.13.0-16.19 [946 kB] Get:7 http://ftpmaster.internal/ubuntu bionic/main ppc64el libgomp1 ppc64el 7.2.0-12ubuntu1 [69.3 kB] Get:8 http://ftpmaster.internal/ubuntu bionic/main ppc64el libitm1 ppc64el 7.2.0-12ubuntu1 [29.7 kB] Get:9 http://ftpmaster.internal/ubuntu bionic/main ppc64el gcc-7-base ppc64el 7.2.0-12ubuntu1 [18.3 kB] Get:10 http://ftpmaster.internal/ubuntu bionic/main ppc64el libgcc1 ppc64el 1:7.2.0-12ubuntu1 [29.7 kB] Get:11 http://ftpmaster.internal/ubuntu bionic/main ppc64el libatomic1 ppc64el 7.2.0-12ubuntu1 [8496 B] Get:12 http://ftpmaster.internal/ubuntu bionic/main ppc64el libasan4 ppc64el 7.2.0-12ubuntu1 [369 kB] Get:13 http://ftpmaster.internal/ubuntu bionic/main ppc64el liblsan0 ppc64el 7.2.0-12ubuntu1 [134 kB] Get:14 http://ftpmaster.internal/ubuntu bionic/main ppc64el libtsan0 ppc64el 7.2.0-12ubuntu1 [289 kB] Get:15 http://ftpmaster.internal/ubuntu bionic/main ppc64el libubsan0 ppc64el 7.2.0-12ubuntu1 [136 kB] Get:16 http://ftpmaster.internal/ubuntu bionic/main ppc64el cpp-7 ppc64el 7.2.0-12ubuntu1 [6261 kB] Get:17 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcc1-0 ppc64el 7.2.0-12ubuntu1 [39.2 kB] Get:18 http://ftpmaster.internal/ubuntu bionic/main ppc64el g++-7 ppc64el 7.2.0-12ubuntu1 [7105 kB] Get:19 http://ftpmaster.internal/ubuntu bionic/main ppc64el gcc-7 ppc64el 7.2.0-12ubuntu1 [6898 kB] Get:20 http://ftpmaster.internal/ubuntu bionic/main ppc64el libgcc-7-dev ppc64el 7.2.0-12ubuntu1 [985 kB] Get:21 http://ftpmaster.internal/ubuntu bionic/main ppc64el libstdc++-7-dev ppc64el 7.2.0-12ubuntu1 [1526 kB] Get:22 http://ftpmaster.internal/ubuntu bionic/main ppc64el libstdc++6 ppc64el 7.2.0-12ubuntu1 [449 kB] Get:23 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libgmp10 ppc64el 2:6.1.2+dfsg-1.1 [218 kB] Get:24 http://ftpmaster.internal/ubuntu bionic/main ppc64el libbinutils ppc64el 2.29.1-6ubuntu1 [457 kB] Get:25 http://ftpmaster.internal/ubuntu bionic/main ppc64el binutils ppc64el 2.29.1-6ubuntu1 [3330 B] Get:26 http://ftpmaster.internal/ubuntu bionic/main ppc64el binutils-common ppc64el 2.29.1-6ubuntu1 [190 kB] Get:27 http://ftpmaster.internal/ubuntu bionic/main ppc64el binutils-powerpc64le-linux-gnu ppc64el 2.29.1-6ubuntu1 [1969 kB] Get:28 http://ftpmaster.internal/ubuntu bionic/main ppc64el libc6 ppc64el 2.26-0ubuntu2 [2619 kB] Get:29 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el e2fslibs ppc64el 1.43.7-1 [173 kB] Get:30 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el e2fsprogs ppc64el 1.43.7-1 [510 kB] Get:31 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el perl-modules-5.26 all 5.26.1-2ubuntu1 [2760 kB] Get:32 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libperl5.26 ppc64el 5.26.1-2ubuntu1 [3405 kB] Get:33 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el perl ppc64el 5.26.1-2ubuntu1 [201 kB] Get:34 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el perl-base ppc64el 5.26.1-2ubuntu1 [1303 kB] Get:35 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el base-passwd ppc64el 3.5.44 [50.1 kB] Get:36 http://ftpmaster.internal/ubuntu bionic/main ppc64el libc-bin ppc64el 2.26-0ubuntu2 [573 kB] Get:37 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libudev1 ppc64el 235-2ubuntu1 [60.5 kB] Get:38 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libapt-pkg5.0 ppc64el 1.6~alpha3 [879 kB] Get:39 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libgpg-error0 ppc64el 1.27-4 [42.1 kB] Get:40 http://ftpmaster.internal/ubuntu bionic/main ppc64el libgcrypt20 ppc64el 1.7.9-1 [438 kB] Get:41 http://ftpmaster.internal/ubuntu bionic/main ppc64el gpgv ppc64el 2.1.15-1ubuntu8 [218 kB] Get:42 http://ftpmaster.internal/ubuntu bionic/main ppc64el libseccomp2 ppc64el 2.3.1-2.1ubuntu3 [47.2 kB] Get:43 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el apt ppc64el 1.6~alpha3 [1191 kB] Get:44 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el debconf all 1.5.64 [124 kB] Get:45 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcap2 ppc64el 1:2.25-1.1 [13.7 kB] Get:46 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpcre3 ppc64el 2:8.39-5ubuntu3 [224 kB] Get:47 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libselinux1 ppc64el 2.7-2 [78.6 kB] Get:48 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el systemd ppc64el 235-2ubuntu1 [2958 kB] Get:49 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libsystemd0 ppc64el 235-2ubuntu1 [213 kB] Get:50 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el systemd-sysv ppc64el 235-2ubuntu1 [12.7 kB] Get:51 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libcap-ng0 ppc64el 0.7.7-3.1 [11.6 kB] Get:52 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libcomerr2 ppc64el 1.43.7-1 [11.6 kB] Get:53 http://ftpmaster.internal/ubuntu bionic/main ppc64el libsemanage-common all 2.7-2 [6916 B] Get:54 http://ftpmaster.internal/ubuntu bionic/main ppc64el libsemanage1 ppc64el 2.7-2 [85.4 kB] Get:55 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libss2 ppc64el 1.43.7-1 [11.4 kB] Get:56 http://ftpmaster.internal/ubuntu bionic/main ppc64el libnettle6 ppc64el 3.3-2 [120 kB] Get:57 http://ftpmaster.internal/ubuntu bionic/main ppc64el libhogweed4 ppc64el 3.3-2 [134 kB] Get:58 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libp11-kit0 ppc64el 0.23.9-2 [167 kB] Get:59 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el pinentry-curses ppc64el 1.0.0-3 [37.5 kB] Get:60 http://ftpmaster.internal/ubuntu bionic/main ppc64el gnupg ppc64el 2.1.15-1ubuntu8 [847 kB] Get:61 http://ftpmaster.internal/ubuntu bionic/main ppc64el gnupg-agent ppc64el 2.1.15-1ubuntu8 [291 kB] Get:62 http://ftpmaster.internal/ubuntu bionic/main ppc64el libsqlite3-0 ppc64el 3.20.1-2 [464 kB] Get:63 http://ftpmaster.internal/ubuntu bionic/main ppc64el multiarch-support ppc64el 2.26-0ubuntu2 [6832 B] Get:64 http://ftpmaster.internal/ubuntu bionic/main ppc64el tzdata all 2017c-1 [188 kB] Get:65 http://ftpmaster.internal/ubuntu bionic/main ppc64el libkeyutils1 ppc64el 1.5.9-9.1ubuntu1 [9896 B] Get:66 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpng16-16 ppc64el 1.6.34-1 [200 kB] Get:67 http://ftpmaster.internal/ubuntu bionic/main ppc64el dpkg-dev all 1.19.0.4ubuntu1 [607 kB] Get:68 http://ftpmaster.internal/ubuntu bionic/main ppc64el libdpkg-perl all 1.19.0.4ubuntu1 [211 kB] Get:69 http://ftpmaster.internal/ubuntu bionic/main ppc64el build-essential ppc64el 12.4ubuntu1 [4754 B] Get:70 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libpsl5 ppc64el 0.18.0-4 [42.6 kB] Get:71 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcurl3-gnutls ppc64el 7.55.1-1ubuntu2.1 [197 kB] debconf: delaying package configuration, since apt-utils is not installed Fetched 54.9 MB in 1s (45.9 MB/s) (Reading database ... 12537 files and directories currently installed.) Preparing to unpack .../base-files_10ubuntu1_ppc64el.deb ... Unpacking base-files (10ubuntu1) over (9.6ubuntu101) ... Setting up base-files (10ubuntu1) ... Installing new version of config file /etc/debian_version ... Installing new version of config file /etc/issue ... Installing new version of config file /etc/issue.net ... Installing new version of config file /etc/lsb-release ... (Reading database ... 12537 files and directories currently installed.) Preparing to unpack .../coreutils_8.26-3ubuntu4_ppc64el.deb ... Unpacking coreutils (8.26-3ubuntu4) over (8.26-3ubuntu3) ... Setting up coreutils (8.26-3ubuntu4) ... (Reading database ... 12537 files and directories currently installed.) Preparing to unpack .../dpkg_1.19.0.4ubuntu1_ppc64el.deb ... Unpacking dpkg (1.19.0.4ubuntu1) over (1.18.24ubuntu1) ... Setting up dpkg (1.19.0.4ubuntu1) ... Installing new version of config file /etc/alternatives/README ... Installing new version of config file /etc/cron.daily/dpkg ... Installing new version of config file /etc/logrotate.d/dpkg ... (Reading database ... 12539 files and directories currently installed.) Preparing to unpack .../0-libc6-dev_2.26-0ubuntu2_ppc64el.deb ... Unpacking libc6-dev:ppc64el (2.26-0ubuntu2) over (2.26-0ubuntu1) ... Preparing to unpack .../1-libc-dev-bin_2.26-0ubuntu2_ppc64el.deb ... Unpacking libc-dev-bin (2.26-0ubuntu2) over (2.26-0ubuntu1) ... Preparing to unpack .../2-linux-libc-dev_4.13.0-16.19_ppc64el.deb ... Unpacking linux-libc-dev:ppc64el (4.13.0-16.19) over (4.13.0-11.12) ... Preparing to unpack .../3-libgomp1_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libgomp1:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../4-libitm1_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libitm1:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../5-gcc-7-base_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking gcc-7-base:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Setting up gcc-7-base:ppc64el (7.2.0-12ubuntu1) ... (Reading database ... 12539 files and directories currently installed.) Preparing to unpack .../libgcc1_1%3a7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libgcc1:ppc64el (1:7.2.0-12ubuntu1) over (1:7.2.0-6ubuntu1) ... Setting up libgcc1:ppc64el (1:7.2.0-12ubuntu1) ... (Reading database ... 12539 files and directories currently installed.) Preparing to unpack .../00-libatomic1_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libatomic1:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../01-libasan4_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libasan4:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Selecting previously unselected package liblsan0:ppc64el. Preparing to unpack .../02-liblsan0_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking liblsan0:ppc64el (7.2.0-12ubuntu1) ... Selecting previously unselected package libtsan0:ppc64el. Preparing to unpack .../03-libtsan0_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libtsan0:ppc64el (7.2.0-12ubuntu1) ... Preparing to unpack .../04-libubsan0_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libubsan0:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../05-cpp-7_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking cpp-7 (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../06-libcc1-0_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libcc1-0:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../07-g++-7_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking g++-7 (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../08-gcc-7_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking gcc-7 (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../09-libgcc-7-dev_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libgcc-7-dev:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../10-libstdc++-7-dev_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libstdc++-7-dev:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Preparing to unpack .../11-libstdc++6_7.2.0-12ubuntu1_ppc64el.deb ... Unpacking libstdc++6:ppc64el (7.2.0-12ubuntu1) over (7.2.0-6ubuntu1) ... Setting up libstdc++6:ppc64el (7.2.0-12ubuntu1) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../libgmp10_2%3a6.1.2+dfsg-1.1_ppc64el.deb ... Unpacking libgmp10:ppc64el (2:6.1.2+dfsg-1.1) over (2:6.1.2+dfsg-1) ... Setting up libgmp10:ppc64el (2:6.1.2+dfsg-1.1) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../libbinutils_2.29.1-6ubuntu1_ppc64el.deb ... Unpacking libbinutils:ppc64el (2.29.1-6ubuntu1) over (2.29.1-1ubuntu1) ... Preparing to unpack .../binutils_2.29.1-6ubuntu1_ppc64el.deb ... Unpacking binutils (2.29.1-6ubuntu1) over (2.29.1-1ubuntu1) ... Preparing to unpack .../binutils-common_2.29.1-6ubuntu1_ppc64el.deb ... Unpacking binutils-common:ppc64el (2.29.1-6ubuntu1) over (2.29.1-1ubuntu1) ... Preparing to unpack .../binutils-powerpc64le-linux-gnu_2.29.1-6ubuntu1_ppc64el.deb ... Unpacking binutils-powerpc64le-linux-gnu (2.29.1-6ubuntu1) over (2.29.1-1ubuntu1) ... Preparing to unpack .../libc6_2.26-0ubuntu2_ppc64el.deb ... Unpacking libc6:ppc64el (2.26-0ubuntu2) over (2.26-0ubuntu1) ... Setting up libc6:ppc64el (2.26-0ubuntu2) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../e2fslibs_1.43.7-1_ppc64el.deb ... Unpacking e2fslibs:ppc64el (1.43.7-1) over (1.43.5-1) ... Setting up e2fslibs:ppc64el (1.43.7-1) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../e2fsprogs_1.43.7-1_ppc64el.deb ... Unpacking e2fsprogs (1.43.7-1) over (1.43.5-1) ... Setting up e2fsprogs (1.43.7-1) ... Installing new version of config file /etc/mke2fs.conf ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../perl_5.26.1-2ubuntu1_ppc64el.deb ... Unpacking perl (5.26.1-2ubuntu1) over (5.26.0-8ubuntu1) ... Preparing to unpack .../perl-modules-5.26_5.26.1-2ubuntu1_all.deb ... Unpacking perl-modules-5.26 (5.26.1-2ubuntu1) over (5.26.0-8ubuntu1) ... Preparing to unpack .../libperl5.26_5.26.1-2ubuntu1_ppc64el.deb ... Unpacking libperl5.26:ppc64el (5.26.1-2ubuntu1) over (5.26.0-8ubuntu1) ... Preparing to unpack .../perl-base_5.26.1-2ubuntu1_ppc64el.deb ... Unpacking perl-base (5.26.1-2ubuntu1) over (5.26.0-8ubuntu1) ... Setting up perl-base (5.26.1-2ubuntu1) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../base-passwd_3.5.44_ppc64el.deb ... Unpacking base-passwd (3.5.44) over (3.5.43) ... Setting up base-passwd (3.5.44) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../libc-bin_2.26-0ubuntu2_ppc64el.deb ... Unpacking libc-bin (2.26-0ubuntu2) over (2.26-0ubuntu1) ... Setting up libc-bin (2.26-0ubuntu2) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../libudev1_235-2ubuntu1_ppc64el.deb ... Unpacking libudev1:ppc64el (235-2ubuntu1) over (234-2ubuntu10) ... Setting up libudev1:ppc64el (235-2ubuntu1) ... (Reading database ... 12554 files and directories currently installed.) Preparing to unpack .../libapt-pkg5.0_1.6~alpha3_ppc64el.deb ... Unpacking libapt-pkg5.0:ppc64el (1.6~alpha3) over (1.5~rc4) ... Setting up libapt-pkg5.0:ppc64el (1.6~alpha3) ... (Reading database ... 12554 files and directories currently installed.) Removing apt-transport-https (1.5~rc4) ... (Reading database ... 12546 files and directories currently installed.) Preparing to unpack .../libgpg-error0_1.27-4_ppc64el.deb ... Unpacking libgpg-error0:ppc64el (1.27-4) over (1.27-3) ... Setting up libgpg-error0:ppc64el (1.27-4) ... (Reading database ... 12546 files and directories currently installed.) Preparing to unpack .../libgcrypt20_1.7.9-1_ppc64el.deb ... Unpacking libgcrypt20:ppc64el (1.7.9-1) over (1.7.8-2ubuntu1) ... Setting up libgcrypt20:ppc64el (1.7.9-1) ... (Reading database ... 12546 files and directories currently installed.) Preparing to unpack .../gpgv_2.1.15-1ubuntu8_ppc64el.deb ... Unpacking gpgv (2.1.15-1ubuntu8) over (2.1.15-1ubuntu7) ... Setting up gpgv (2.1.15-1ubuntu8) ... (Reading database ... 12546 files and directories currently installed.) Preparing to unpack .../libseccomp2_2.3.1-2.1ubuntu3_ppc64el.deb ... Unpacking libseccomp2:ppc64el (2.3.1-2.1ubuntu3) over (2.3.1-2.1ubuntu2) ... Setting up libseccomp2:ppc64el (2.3.1-2.1ubuntu3) ... (Reading database ... 12546 files and directories currently installed.) Preparing to unpack .../apt_1.6~alpha3_ppc64el.deb ... Unpacking apt (1.6~alpha3) over (1.5~rc4) ... Setting up apt (1.6~alpha3) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../debconf_1.5.64_all.deb ... Unpacking debconf (1.5.64) over (1.5.63) ... Setting up debconf (1.5.64) ... (Reading database ... 12536 files and directories currently installed.) Preparing to unpack .../libcap2_1%3a2.25-1.1_ppc64el.deb ... Unpacking libcap2:ppc64el (1:2.25-1.1) over (1:2.25-1) ... Preparing to unpack .../libpcre3_2%3a8.39-5ubuntu3_ppc64el.deb ... Unpacking libpcre3:ppc64el (2:8.39-5ubuntu3) over (2:8.39-4) ... Setting up libpcre3:ppc64el (2:8.39-5ubuntu3) ... (Reading database ... 12536 files and directories currently installed.) Preparing to unpack .../libselinux1_2.7-2_ppc64el.deb ... Unpacking libselinux1:ppc64el (2.7-2) over (2.7-1) ... Setting up libselinux1:ppc64el (2.7-2) ... (Reading database ... 12536 files and directories currently installed.) Preparing to unpack .../systemd_235-2ubuntu1_ppc64el.deb ... Unpacking systemd (235-2ubuntu1) over (234-2ubuntu10) ... Preparing to unpack .../libsystemd0_235-2ubuntu1_ppc64el.deb ... Unpacking libsystemd0:ppc64el (235-2ubuntu1) over (234-2ubuntu10) ... Setting up libsystemd0:ppc64el (235-2ubuntu1) ... Setting up libcap2:ppc64el (1:2.25-1.1) ... Setting up systemd (235-2ubuntu1) ... Installing new version of config file /etc/systemd/journald.conf ... Installing new version of config file /etc/systemd/system.conf ... Removing empty /etc/rc.local Removed /etc/systemd/system/network-online.target.wants/systemd-networkd-wait-online.service. (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../systemd-sysv_235-2ubuntu1_ppc64el.deb ... Unpacking systemd-sysv (235-2ubuntu1) over (234-2ubuntu10) ... Preparing to unpack .../libcap-ng0_0.7.7-3.1_ppc64el.deb ... Unpacking libcap-ng0:ppc64el (0.7.7-3.1) over (0.7.7-3build1) ... Setting up libcap-ng0:ppc64el (0.7.7-3.1) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libcomerr2_1.43.7-1_ppc64el.deb ... Unpacking libcomerr2:ppc64el (1.43.7-1) over (1.43.5-1) ... Setting up libcomerr2:ppc64el (1.43.7-1) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libsemanage-common_2.7-2_all.deb ... Unpacking libsemanage-common (2.7-2) over (2.7-1) ... Setting up libsemanage-common (2.7-2) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libsemanage1_2.7-2_ppc64el.deb ... Unpacking libsemanage1:ppc64el (2.7-2) over (2.7-1) ... Setting up libsemanage1:ppc64el (2.7-2) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libss2_1.43.7-1_ppc64el.deb ... Unpacking libss2:ppc64el (1.43.7-1) over (1.43.5-1) ... Setting up libss2:ppc64el (1.43.7-1) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libnettle6_3.3-2_ppc64el.deb ... Unpacking libnettle6:ppc64el (3.3-2) over (3.3-1) ... Setting up libnettle6:ppc64el (3.3-2) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libhogweed4_3.3-2_ppc64el.deb ... Unpacking libhogweed4:ppc64el (3.3-2) over (3.3-1) ... Setting up libhogweed4:ppc64el (3.3-2) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../libp11-kit0_0.23.9-2_ppc64el.deb ... Unpacking libp11-kit0:ppc64el (0.23.9-2) over (0.23.7-3) ... Setting up libp11-kit0:ppc64el (0.23.9-2) ... (Reading database ... 12542 files and directories currently installed.) Preparing to unpack .../00-pinentry-curses_1.0.0-3_ppc64el.deb ... Unpacking pinentry-curses (1.0.0-3) over (1.0.0-2) ... Preparing to unpack .../01-gnupg_2.1.15-1ubuntu8_ppc64el.deb ... Unpacking gnupg (2.1.15-1ubuntu8) over (2.1.15-1ubuntu7) ... Preparing to unpack .../02-gnupg-agent_2.1.15-1ubuntu8_ppc64el.deb ... Unpacking gnupg-agent (2.1.15-1ubuntu8) over (2.1.15-1ubuntu7) ... Preparing to unpack .../03-libsqlite3-0_3.20.1-2_ppc64el.deb ... Unpacking libsqlite3-0:ppc64el (3.20.1-2) over (3.19.3-3) ... Preparing to unpack .../04-multiarch-support_2.26-0ubuntu2_ppc64el.deb ... Unpacking multiarch-support (2.26-0ubuntu2) over (2.26-0ubuntu1) ... Preparing to unpack .../05-tzdata_2017c-1_all.deb ... Unpacking tzdata (2017c-1) over (2017b-2) ... Preparing to unpack .../06-libkeyutils1_1.5.9-9.1ubuntu1_ppc64el.deb ... Unpacking libkeyutils1:ppc64el (1.5.9-9.1ubuntu1) over (1.5.9-9ubuntu1) ... Preparing to unpack .../07-libpng16-16_1.6.34-1_ppc64el.deb ... Unpacking libpng16-16:ppc64el (1.6.34-1) over (1.6.32-2) ... Preparing to unpack .../08-dpkg-dev_1.19.0.4ubuntu1_all.deb ... Unpacking dpkg-dev (1.19.0.4ubuntu1) over (1.18.24ubuntu1) ... Preparing to unpack .../09-libdpkg-perl_1.19.0.4ubuntu1_all.deb ... Unpacking libdpkg-perl (1.19.0.4ubuntu1) over (1.18.24ubuntu1) ... Preparing to unpack .../10-build-essential_12.4ubuntu1_ppc64el.deb ... Unpacking build-essential (12.4ubuntu1) over (12.1ubuntu2) ... Preparing to unpack .../11-libpsl5_0.18.0-4_ppc64el.deb ... Unpacking libpsl5:ppc64el (0.18.0-4) over (0.18.0-2) ... Preparing to unpack .../12-libcurl3-gnutls_7.55.1-1ubuntu2.1_ppc64el.deb ... Unpacking libcurl3-gnutls:ppc64el (7.55.1-1ubuntu2.1) over (7.55.1-1ubuntu1) ... Setting up libgomp1:ppc64el (7.2.0-12ubuntu1) ... Setting up libatomic1:ppc64el (7.2.0-12ubuntu1) ... Setting up libcc1-0:ppc64el (7.2.0-12ubuntu1) ... Setting up libasan4:ppc64el (7.2.0-12ubuntu1) ... Setting up libpng16-16:ppc64el (1.6.34-1) ... Setting up libpsl5:ppc64el (0.18.0-4) ... Setting up multiarch-support (2.26-0ubuntu2) ... Setting up tzdata (2017c-1) ... Current default time zone: 'Etc/UTC' Local time is now: Wed Nov 1 17:15:56 UTC 2017. Universal Time is now: Wed Nov 1 17:15:56 UTC 2017. Run 'dpkg-reconfigure tzdata' if you wish to change it. Setting up systemd-sysv (235-2ubuntu1) ... Setting up libubsan0:ppc64el (7.2.0-12ubuntu1) ... Setting up libtsan0:ppc64el (7.2.0-12ubuntu1) ... Setting up linux-libc-dev:ppc64el (4.13.0-16.19) ... Setting up perl-modules-5.26 (5.26.1-2ubuntu1) ... Setting up cpp-7 (7.2.0-12ubuntu1) ... Setting up liblsan0:ppc64el (7.2.0-12ubuntu1) ... Setting up binutils-common:ppc64el (2.29.1-6ubuntu1) ... Processing triggers for libc-bin (2.26-0ubuntu2) ... Setting up libperl5.26:ppc64el (5.26.1-2ubuntu1) ... Setting up libsqlite3-0:ppc64el (3.20.1-2) ... Setting up pinentry-curses (1.0.0-3) ... Setting up libc-dev-bin (2.26-0ubuntu2) ... Setting up libkeyutils1:ppc64el (1.5.9-9.1ubuntu1) ... Setting up gnupg-agent (2.1.15-1ubuntu8) ... Setting up libc6-dev:ppc64el (2.26-0ubuntu2) ... Setting up libitm1:ppc64el (7.2.0-12ubuntu1) ... Setting up libbinutils:ppc64el (2.29.1-6ubuntu1) ... Setting up libcurl3-gnutls:ppc64el (7.55.1-1ubuntu2.1) ... Setting up binutils-powerpc64le-linux-gnu (2.29.1-6ubuntu1) ... Setting up gnupg (2.1.15-1ubuntu8) ... Setting up libgcc-7-dev:ppc64el (7.2.0-12ubuntu1) ... Setting up libstdc++-7-dev:ppc64el (7.2.0-12ubuntu1) ... Setting up perl (5.26.1-2ubuntu1) ... Setting up binutils (2.29.1-6ubuntu1) ... Setting up gcc-7 (7.2.0-12ubuntu1) ... Setting up g++-7 (7.2.0-12ubuntu1) ... Setting up libdpkg-perl (1.19.0.4ubuntu1) ... Setting up dpkg-dev (1.19.0.4ubuntu1) ... Setting up build-essential (12.4ubuntu1) ... Processing triggers for libc-bin (2.26-0ubuntu2) ... RUN: /usr/share/launchpad-buildd/slavebin/sbuild-package PACKAGEBUILD-13664339 ppc64el bionic-proposed -c chroot:build-PACKAGEBUILD-13664339 --arch=ppc64el --dist=bionic-proposed --nolog wise_2.4.1-20.dsc Initiating build PACKAGEBUILD-13664339 with 4 jobs across 4 processor cores. Kernel reported to sbuild: 4.4.0-97-generic #120-Ubuntu SMP Tue Sep 19 17:26:02 UTC 2017 ppc64le sbuild (Debian sbuild) 0.67.0 (26 Dec 2015) on bos01-ppc64el-013.buildd +==============================================================================+ | wise 2.4.1-20 (ppc64el) 01 Nov 2017 17:15 | +==============================================================================+ Package: wise Version: 2.4.1-20 Source Version: 2.4.1-20 Distribution: bionic-proposed Machine Architecture: ppc64el Host Architecture: ppc64el Build Architecture: ppc64el I: NOTICE: Log filtering will replace 'build/wise-ZUCPGU/wise-2.4.1' with '<>' I: NOTICE: Log filtering will replace 'build/wise-ZUCPGU' with '<>' I: NOTICE: Log filtering will replace 'home/buildd/build-PACKAGEBUILD-13664339/chroot-autobuild' with '<>' +------------------------------------------------------------------------------+ | Fetch source files | +------------------------------------------------------------------------------+ Local sources ------------- wise_2.4.1-20.dsc exists in .; copying to chroot Check architectures ------------------- Check dependencies ------------------ Merged Build-Depends: build-essential, fakeroot Filtered Build-Depends: build-essential, fakeroot dpkg-deb: building package 'sbuild-build-depends-core-dummy' in '/<>/resolver-5iLwyz/apt_archive/sbuild-build-depends-core-dummy.deb'. Ign:1 copy:/<>/resolver-5iLwyz/apt_archive ./ InRelease Get:2 copy:/<>/resolver-5iLwyz/apt_archive ./ Release [2119 B] Ign:3 copy:/<>/resolver-5iLwyz/apt_archive ./ Release.gpg Get:4 copy:/<>/resolver-5iLwyz/apt_archive ./ Sources [214 B] Get:5 copy:/<>/resolver-5iLwyz/apt_archive ./ Packages [527 B] Fetched 2860 B in 0s (114 kB/s) Reading package lists... Reading package lists... +------------------------------------------------------------------------------+ | Install core build dependencies (apt-based resolver) | +------------------------------------------------------------------------------+ Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following packages were automatically installed and are no longer required: libasn1-8-heimdal libcurl3-gnutls libgssapi-krb5-2 libgssapi3-heimdal libhcrypto4-heimdal libheimbase1-heimdal libheimntlm0-heimdal libhx509-5-heimdal libidn2-0 libk5crypto3 libkeyutils1 libkrb5-26-heimdal libkrb5-3 libkrb5support0 libldap-2.4-2 libldap-common libpsl5 libroken18-heimdal librtmp1 libsasl2-2 libsasl2-modules-db libunistring0 libwind0-heimdal Use 'apt autoremove' to remove them. The following NEW packages will be installed: sbuild-build-depends-core-dummy 0 upgraded, 1 newly installed, 0 to remove and 0 not upgraded. Need to get 856 B of archives. After this operation, 0 B of additional disk space will be used. Get:1 copy:/<>/resolver-5iLwyz/apt_archive ./ sbuild-build-depends-core-dummy 0.invalid.0 [856 B] debconf: delaying package configuration, since apt-utils is not installed Fetched 856 B in 0s (0 B/s) Selecting previously unselected package sbuild-build-depends-core-dummy. (Reading database ... 12543 files and directories currently installed.) Preparing to unpack .../sbuild-build-depends-core-dummy_0.invalid.0_ppc64el.deb ... Unpacking sbuild-build-depends-core-dummy (0.invalid.0) ... Setting up sbuild-build-depends-core-dummy (0.invalid.0) ... Merged Build-Depends: debhelper (>= 10), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev Filtered Build-Depends: debhelper (>= 10), texlive-latex-base, texlive-extra-utils, hevea, docbook-to-man, libglib2.0-dev dpkg-deb: building package 'sbuild-build-depends-wise-dummy' in '/<>/resolver-etNDgE/apt_archive/sbuild-build-depends-wise-dummy.deb'. Ign:1 copy:/<>/resolver-etNDgE/apt_archive ./ InRelease Get:2 copy:/<>/resolver-etNDgE/apt_archive ./ Release [2119 B] Ign:3 copy:/<>/resolver-etNDgE/apt_archive ./ Release.gpg Get:4 copy:/<>/resolver-etNDgE/apt_archive ./ Sources [253 B] Get:5 copy:/<>/resolver-etNDgE/apt_archive ./ Packages [575 B] Fetched 2947 B in 0s (226 kB/s) Reading package lists... Reading package lists... +------------------------------------------------------------------------------+ | Install wise build dependencies (apt-based resolver) | +------------------------------------------------------------------------------+ Installing build dependencies Reading package lists... Building dependency tree... Reading state information... The following packages were automatically installed and are no longer required: libasn1-8-heimdal libcurl3-gnutls libgssapi3-heimdal libhcrypto4-heimdal libheimbase1-heimdal libheimntlm0-heimdal libhx509-5-heimdal libidn2-0 libkrb5-26-heimdal libldap-2.4-2 libldap-common libpsl5 libroken18-heimdal librtmp1 libsasl2-2 libsasl2-modules-db libwind0-heimdal Use 'apt autoremove' to remove them. The following additional packages will be installed: autoconf automake autopoint autotools-dev bsdmainutils debhelper dh-autoreconf dh-python dh-strip-nondeterminism docbook docbook-to-man file fontconfig-config fonts-dejavu-core fonts-lmodern gettext gettext-base ghostscript groff-base hevea intltool-debian libarchive-zip-perl libavahi-client3 libavahi-common-data libavahi-common3 libbsd0 libcairo2 libcroco3 libcups2 libcupsimage2 libdatrie1 libdbus-1-3 libelf1 libexpat1 libfile-stripnondeterminism-perl libfontconfig1 libfreetype6 libglib2.0-0 libglib2.0-bin libglib2.0-data libglib2.0-dev libglib2.0-dev-bin libgraphite2-3 libgs9 libgs9-common libharfbuzz-icu0 libharfbuzz0b libice6 libicu59 libijs-0.35 libjbig0 libjbig2dec0 libjpeg-turbo8 libjpeg8 libkpathsea6 liblcms2-2 libmagic-mgc libmagic1 libmime-charset-perl libmpdec2 libnetpbm10 libnspr4 libnss3 libosp5 libpaper-utils libpaper1 libpcre16-3 libpcre3-dev libpcre32-3 libpcrecpp0v5 libpipeline1 libpixman-1-0 libpoppler68 libpotrace0 libptexenc1 libpython-stdlib libpython2.7-minimal libpython2.7-stdlib libpython3-stdlib libpython3.6-minimal libpython3.6-stdlib libsigsegv2 libsm6 libsombok3 libsynctex1 libtexlua52 libthai-data libthai0 libtiff5 libtimedate-perl libtool libunicode-linebreak-perl libx11-6 libx11-data libxau6 libxaw7 libxcb-render0 libxcb-shm0 libxcb1 libxdmcp6 libxext6 libxi6 libxml2 libxmu6 libxpm4 libxrender1 libxt6 libzzip-0-13 m4 man-db mime-support netpbm ocaml-base-nox opensp pkg-config po-debconf poppler-data python python-minimal python2.7 python2.7-minimal python3 python3-minimal python3.6 python3.6-minimal sgml-base sgml-data t1utils tex-common texlive-base texlive-binaries texlive-extra-utils texlive-latex-base ucf x11-common xdg-utils xml-core zlib1g-dev Suggested packages: autoconf-archive gnu-standards autoconf-doc wamerican | wordlist whois vacation dh-make dwz docbook-defguide docbook-dsssl docbook-xml psgml gettext-doc libasprintf-dev libgettextpo-dev ghostscript-x groff hevea-doc texlive-latex-extra cups-common libglib2.0-doc liblcms2-utils libencode-hanextra-perl libpod2-base-perl libtool-doc gfortran | fortran95-compiler gcj-jdk m4-doc less www-browser doc-base libmail-box-perl poppler-utils fonts-japanese-mincho | fonts-ipafont-mincho fonts-japanese-gothic | fonts-ipafont-gothic fonts-arphic-ukai fonts-arphic-uming fonts-nanum python-doc python-tk python2.7-doc binfmt-support python3-doc python3-tk python3-venv python3.6-venv python3.6-doc sgml-base-doc perlsgml w3-recs libxml2-utils perl-tk xpdf-reader | pdf-viewer chktex dvidvi dvipng fragmaster lacheck latexdiff latexmk purifyeps xindy Recommended packages: curl | wget | lynx-cur gsfonts libcupsfilters1 dbus libarchive-cpio-perl shared-mime-info xdg-user-dirs fonts-droid-fallback libltdl-dev libmail-sendmail-perl lmodern ruby wish libfile-homedir-perl libyaml-tiny-perl ruby | ruby-interpreter texlive-latex-recommended texlive-latex-base-doc libfile-mimeinfo-perl libnet-dbus-perl libx11-protocol-perl x11-utils x11-xserver-utils The following packages will be REMOVED: pkg-create-dbgsym* The following NEW packages will be installed: autoconf automake autopoint autotools-dev bsdmainutils debhelper dh-autoreconf dh-python dh-strip-nondeterminism docbook docbook-to-man file fontconfig-config fonts-dejavu-core fonts-lmodern gettext gettext-base ghostscript groff-base hevea intltool-debian libarchive-zip-perl libavahi-client3 libavahi-common-data libavahi-common3 libbsd0 libcairo2 libcroco3 libcups2 libcupsimage2 libdatrie1 libdbus-1-3 libelf1 libexpat1 libfile-stripnondeterminism-perl libfontconfig1 libfreetype6 libglib2.0-0 libglib2.0-bin libglib2.0-data libglib2.0-dev libglib2.0-dev-bin libgraphite2-3 libgs9 libgs9-common libharfbuzz-icu0 libharfbuzz0b libice6 libicu59 libijs-0.35 libjbig0 libjbig2dec0 libjpeg-turbo8 libjpeg8 libkpathsea6 liblcms2-2 libmagic-mgc libmagic1 libmime-charset-perl libmpdec2 libnetpbm10 libnspr4 libnss3 libosp5 libpaper-utils libpaper1 libpcre16-3 libpcre3-dev libpcre32-3 libpcrecpp0v5 libpipeline1 libpixman-1-0 libpoppler68 libpotrace0 libptexenc1 libpython-stdlib libpython2.7-minimal libpython2.7-stdlib libpython3-stdlib libpython3.6-minimal libpython3.6-stdlib libsigsegv2 libsm6 libsombok3 libsynctex1 libtexlua52 libthai-data libthai0 libtiff5 libtimedate-perl libtool libunicode-linebreak-perl libx11-6 libx11-data libxau6 libxaw7 libxcb-render0 libxcb-shm0 libxcb1 libxdmcp6 libxext6 libxi6 libxml2 libxmu6 libxpm4 libxrender1 libxt6 libzzip-0-13 m4 man-db mime-support netpbm ocaml-base-nox opensp pkg-config po-debconf poppler-data python python-minimal python2.7 python2.7-minimal python3 python3-minimal python3.6 python3.6-minimal sbuild-build-depends-wise-dummy sgml-base sgml-data t1utils tex-common texlive-base texlive-binaries texlive-extra-utils texlive-latex-base ucf x11-common xdg-utils xml-core zlib1g-dev 0 upgraded, 139 newly installed, 1 to remove and 0 not upgraded. Need to get 103 MB of archives. After this operation, 378 MB of additional disk space will be used. Get:1 copy:/<>/resolver-etNDgE/apt_archive ./ sbuild-build-depends-wise-dummy 0.invalid.0 [908 B] Get:2 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpython3.6-minimal ppc64el 3.6.3-1ubuntu1 [532 kB] Get:3 http://ftpmaster.internal/ubuntu bionic/main ppc64el libexpat1 ppc64el 2.2.3-1 [76.2 kB] Get:4 http://ftpmaster.internal/ubuntu bionic/main ppc64el python3.6-minimal ppc64el 3.6.3-1ubuntu1 [1532 kB] Get:5 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el python3-minimal ppc64el 3.6.3-2 [23.7 kB] Get:6 http://ftpmaster.internal/ubuntu bionic/main ppc64el mime-support all 3.60ubuntu1 [30.1 kB] Get:7 http://ftpmaster.internal/ubuntu bionic/main ppc64el libmpdec2 ppc64el 2.4.2-1 [82.6 kB] Get:8 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpython3.6-stdlib ppc64el 3.6.3-1ubuntu1 [2140 kB] Get:9 http://ftpmaster.internal/ubuntu bionic/main ppc64el python3.6 ppc64el 3.6.3-1ubuntu1 [175 kB] Get:10 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libpython3-stdlib ppc64el 3.6.3-2 [7204 B] Get:11 http://ftpmaster.internal/ubuntu bionic/main ppc64el dh-python all 2.20170125 [83.7 kB] Get:12 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el python3 ppc64el 3.6.3-2 [8768 B] Get:13 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxau6 ppc64el 1:1.0.8-1 [7460 B] Get:14 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libbsd0 ppc64el 0.8.6-2 [50.1 kB] Get:15 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxdmcp6 ppc64el 1:1.1.2-3 [11.0 kB] Get:16 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxcb1 ppc64el 1.12-1ubuntu1 [43.9 kB] Get:17 http://ftpmaster.internal/ubuntu bionic/main ppc64el libx11-data all 2:1.6.4-3 [114 kB] Get:18 http://ftpmaster.internal/ubuntu bionic/main ppc64el libx11-6 ppc64el 2:1.6.4-3 [566 kB] Get:19 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxext6 ppc64el 2:1.3.3-1 [30.7 kB] Get:20 http://ftpmaster.internal/ubuntu bionic/main ppc64el groff-base ppc64el 1.22.3-9 [1361 kB] Get:21 http://ftpmaster.internal/ubuntu bionic/main ppc64el bsdmainutils ppc64el 9.0.12+nmu1ubuntu1 [179 kB] Get:22 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpipeline1 ppc64el 1.4.2-1 [23.6 kB] Get:23 http://ftpmaster.internal/ubuntu bionic/main ppc64el man-db ppc64el 2.7.6.1-2 [890 kB] Get:24 http://ftpmaster.internal/ubuntu bionic/main ppc64el libjpeg-turbo8 ppc64el 1.5.2-0ubuntu5 [146 kB] Get:25 http://ftpmaster.internal/ubuntu bionic/main ppc64el x11-common all 1:7.7+19ubuntu3 [22.0 kB] Get:26 http://ftpmaster.internal/ubuntu bionic/main ppc64el libice6 ppc64el 2:1.0.9-2 [38.0 kB] Get:27 http://ftpmaster.internal/ubuntu bionic/main ppc64el libsm6 ppc64el 2:1.2.2-1 [15.1 kB] Get:28 http://ftpmaster.internal/ubuntu bionic/main ppc64el poppler-data all 0.4.8-1 [1476 kB] Get:29 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpython2.7-minimal ppc64el 2.7.14-2ubuntu2 [338 kB] Get:30 http://ftpmaster.internal/ubuntu bionic/main ppc64el python2.7-minimal ppc64el 2.7.14-2ubuntu2 [1439 kB] Get:31 http://ftpmaster.internal/ubuntu bionic/main ppc64el python-minimal ppc64el 2.7.14-2ubuntu1 [28.1 kB] Get:32 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpython2.7-stdlib ppc64el 2.7.14-2ubuntu2 [2007 kB] Get:33 http://ftpmaster.internal/ubuntu bionic/main ppc64el python2.7 ppc64el 2.7.14-2ubuntu2 [233 kB] Get:34 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpython-stdlib ppc64el 2.7.14-2ubuntu1 [7576 B] Get:35 http://ftpmaster.internal/ubuntu bionic/main ppc64el python ppc64el 2.7.14-2ubuntu1 [140 kB] Get:36 http://ftpmaster.internal/ubuntu bionic/main ppc64el sgml-base all 1.29 [12.3 kB] Get:37 http://ftpmaster.internal/ubuntu bionic/main ppc64el ucf all 3.0036 [52.9 kB] Get:38 http://ftpmaster.internal/ubuntu bionic/main ppc64el tex-common all 6.09 [33.0 kB] Get:39 http://ftpmaster.internal/ubuntu bionic/main ppc64el libjbig0 ppc64el 2.1-3.1 [26.4 kB] Get:40 http://ftpmaster.internal/ubuntu bionic/main ppc64el libmagic-mgc ppc64el 1:5.32-1 [184 kB] Get:41 http://ftpmaster.internal/ubuntu bionic/main ppc64el libmagic1 ppc64el 1:5.32-1 [76.6 kB] Get:42 http://ftpmaster.internal/ubuntu bionic/main ppc64el file ppc64el 1:5.32-1 [22.7 kB] Get:43 http://ftpmaster.internal/ubuntu bionic/main ppc64el libdbus-1-3 ppc64el 1.12.0-1ubuntu1 [182 kB] Get:44 http://ftpmaster.internal/ubuntu bionic/main ppc64el libelf1 ppc64el 0.170-0.1 [46.6 kB] Get:45 http://ftpmaster.internal/ubuntu bionic/main ppc64el libglib2.0-0 ppc64el 2.54.1-1ubuntu1 [1160 kB] Get:46 http://ftpmaster.internal/ubuntu bionic/main ppc64el libglib2.0-data all 2.54.1-1ubuntu1 [4250 B] Get:47 http://ftpmaster.internal/ubuntu bionic/main ppc64el libicu59 ppc64el 59.1-3ubuntu1 [8110 kB] Get:48 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxml2 ppc64el 2.9.4+dfsg1-5ubuntu1 [621 kB] Get:49 http://ftpmaster.internal/ubuntu bionic/main ppc64el gettext-base ppc64el 0.19.8.1-4ubuntu1 [49.5 kB] Get:50 http://ftpmaster.internal/ubuntu bionic/main ppc64el libsigsegv2 ppc64el 2.11-1 [13.3 kB] Get:51 http://ftpmaster.internal/ubuntu bionic/main ppc64el m4 ppc64el 1.4.18-1 [202 kB] Get:52 http://ftpmaster.internal/ubuntu bionic/main ppc64el autoconf all 2.69-11 [322 kB] Get:53 http://ftpmaster.internal/ubuntu bionic/main ppc64el autotools-dev all 20161112.1+nmu1 [40.2 kB] Get:54 http://ftpmaster.internal/ubuntu bionic/main ppc64el automake all 1:1.15.1-3ubuntu1 [509 kB] Get:55 http://ftpmaster.internal/ubuntu bionic/main ppc64el autopoint all 0.19.8.1-4ubuntu1 [412 kB] Get:56 http://ftpmaster.internal/ubuntu bionic/main ppc64el libtool all 2.4.6-2 [194 kB] Get:57 http://ftpmaster.internal/ubuntu bionic/main ppc64el dh-autoreconf all 14 [15.5 kB] Get:58 http://ftpmaster.internal/ubuntu bionic/main ppc64el libarchive-zip-perl all 1.59-1 [84.0 kB] Get:59 http://ftpmaster.internal/ubuntu bionic/main ppc64el libfile-stripnondeterminism-perl all 0.039-1 [13.8 kB] Get:60 http://ftpmaster.internal/ubuntu bionic/main ppc64el libtimedate-perl all 2.3000-2 [37.5 kB] Get:61 http://ftpmaster.internal/ubuntu bionic/main ppc64el dh-strip-nondeterminism all 0.039-1 [5192 B] Get:62 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcroco3 ppc64el 0.6.12-1 [74.4 kB] Get:63 http://ftpmaster.internal/ubuntu bionic/main ppc64el gettext ppc64el 0.19.8.1-4ubuntu1 [1142 kB] Get:64 http://ftpmaster.internal/ubuntu bionic/main ppc64el intltool-debian all 0.35.0+20060710.4 [24.9 kB] Get:65 http://ftpmaster.internal/ubuntu bionic/main ppc64el po-debconf all 1.0.20 [232 kB] Get:66 http://ftpmaster.internal/ubuntu bionic/main ppc64el debhelper all 10.10.5ubuntu1 [876 kB] Get:67 http://ftpmaster.internal/ubuntu bionic/main ppc64el xml-core all 0.17 [21.6 kB] Get:68 http://ftpmaster.internal/ubuntu bionic/main ppc64el sgml-data all 2.0.10 [173 kB] Get:69 http://ftpmaster.internal/ubuntu bionic/universe ppc64el docbook all 4.5-6 [122 kB] Get:70 http://ftpmaster.internal/ubuntu bionic/main ppc64el libosp5 ppc64el 1.5.2-13ubuntu2 [620 kB] Get:71 http://ftpmaster.internal/ubuntu bionic/main ppc64el opensp ppc64el 1.5.2-13ubuntu2 [156 kB] Get:72 http://ftpmaster.internal/ubuntu bionic-proposed/universe ppc64el docbook-to-man ppc64el 1:2.0.0-40 [94.3 kB] Get:73 http://ftpmaster.internal/ubuntu bionic/main ppc64el fonts-dejavu-core all 2.37-1 [1041 kB] Get:74 http://ftpmaster.internal/ubuntu bionic/main ppc64el fontconfig-config all 2.12.6-0ubuntu1 [55.5 kB] Get:75 http://ftpmaster.internal/ubuntu bionic/main ppc64el fonts-lmodern all 2.004.5-3 [4551 kB] Get:76 http://ftpmaster.internal/ubuntu bionic/main ppc64el libavahi-common-data ppc64el 0.6.32-1ubuntu1 [22.1 kB] Get:77 http://ftpmaster.internal/ubuntu bionic/main ppc64el libavahi-common3 ppc64el 0.6.32-1ubuntu1 [19.5 kB] Get:78 http://ftpmaster.internal/ubuntu bionic/main ppc64el libavahi-client3 ppc64el 0.6.32-1ubuntu1 [22.5 kB] Get:79 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcups2 ppc64el 2.2.5-2 [240 kB] Get:80 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcupsimage2 ppc64el 2.2.5-2 [24.2 kB] Get:81 http://ftpmaster.internal/ubuntu bionic/main ppc64el libfreetype6 ppc64el 2.8-0.2ubuntu2 [385 kB] Get:82 http://ftpmaster.internal/ubuntu bionic/main ppc64el libfontconfig1 ppc64el 2.12.6-0ubuntu1 [166 kB] Get:83 http://ftpmaster.internal/ubuntu bionic/main ppc64el libijs-0.35 ppc64el 0.35-12 [15.0 kB] Get:84 http://ftpmaster.internal/ubuntu bionic/main ppc64el libjbig2dec0 ppc64el 0.13-5 [57.4 kB] Get:85 http://ftpmaster.internal/ubuntu bionic/main ppc64el libjpeg8 ppc64el 8c-2ubuntu8 [2146 B] Get:86 http://ftpmaster.internal/ubuntu bionic/main ppc64el liblcms2-2 ppc64el 2.7-1ubuntu1 [164 kB] Get:87 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpaper1 ppc64el 1.1.24+nmu5ubuntu1 [13.4 kB] Get:88 http://ftpmaster.internal/ubuntu bionic/main ppc64el libtiff5 ppc64el 4.0.8-6 [165 kB] Get:89 http://ftpmaster.internal/ubuntu bionic/main ppc64el libgs9-common all 9.21~dfsg+1-0ubuntu3 [5121 kB] Get:90 http://ftpmaster.internal/ubuntu bionic/main ppc64el libgs9 ppc64el 9.21~dfsg+1-0ubuntu3 [2483 kB] Get:91 http://ftpmaster.internal/ubuntu bionic/main ppc64el ghostscript ppc64el 9.21~dfsg+1-0ubuntu3 [49.9 kB] Get:92 http://ftpmaster.internal/ubuntu bionic/main ppc64el libnetpbm10 ppc64el 2:10.0-15.3build1 [56.1 kB] Get:93 http://ftpmaster.internal/ubuntu bionic/main ppc64el netpbm ppc64el 2:10.0-15.3build1 [1049 kB] Get:94 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpaper-utils ppc64el 1.1.24+nmu5ubuntu1 [8368 B] Get:95 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libkpathsea6 ppc64el 2017.20170613.44572-6 [58.7 kB] Get:96 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libptexenc1 ppc64el 2017.20170613.44572-6 [35.8 kB] Get:97 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libsynctex1 ppc64el 2017.20170613.44572-6 [40.6 kB] Get:98 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libtexlua52 ppc64el 2017.20170613.44572-6 [107 kB] Get:99 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el t1utils ppc64el 1.41-1 [61.9 kB] Get:100 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpixman-1-0 ppc64el 0.34.0-1 [201 kB] Get:101 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxcb-render0 ppc64el 1.12-1ubuntu1 [13.4 kB] Get:102 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxcb-shm0 ppc64el 1.12-1ubuntu1 [5494 B] Get:103 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxrender1 ppc64el 1:0.9.10-1 [17.6 kB] Get:104 http://ftpmaster.internal/ubuntu bionic/main ppc64el libcairo2 ppc64el 1.15.8-2 [670 kB] Get:105 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libgraphite2-3 ppc64el 1.3.10-6 [66.6 kB] Get:106 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libharfbuzz0b ppc64el 1.6.2-1 [227 kB] Get:107 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libharfbuzz-icu0 ppc64el 1.6.2-1 [5444 B] Get:108 http://ftpmaster.internal/ubuntu bionic/main ppc64el libnspr4 ppc64el 2:4.16-1ubuntu2 [105 kB] Get:109 http://ftpmaster.internal/ubuntu bionic/main ppc64el libnss3 ppc64el 2:3.32-1ubuntu3 [1174 kB] Get:110 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpoppler68 ppc64el 0.57.0-2ubuntu4 [843 kB] Get:111 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpotrace0 ppc64el 1.14-2 [18.3 kB] Get:112 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxt6 ppc64el 1:1.1.5-1 [152 kB] Get:113 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxmu6 ppc64el 2:1.1.2-2 [43.4 kB] Get:114 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxpm4 ppc64el 1:3.5.12-1 [35.9 kB] Get:115 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxaw7 ppc64el 2:1.0.13-1 [176 kB] Get:116 http://ftpmaster.internal/ubuntu bionic/main ppc64el libxi6 ppc64el 2:1.7.9-1 [29.0 kB] Get:117 http://ftpmaster.internal/ubuntu bionic/main ppc64el libzzip-0-13 ppc64el 0.13.62-3.1 [24.5 kB] Get:118 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el texlive-binaries ppc64el 2017.20170613.44572-6 [8582 kB] Get:119 http://ftpmaster.internal/ubuntu bionic/main ppc64el xdg-utils all 1.1.1-1ubuntu3 [59.4 kB] Get:120 http://ftpmaster.internal/ubuntu bionic/main ppc64el texlive-base all 2017.20170818-1 [18.6 MB] Get:121 http://ftpmaster.internal/ubuntu bionic-proposed/universe ppc64el ocaml-base-nox ppc64el 4.05.0-10ubuntu1 [542 kB] Get:122 http://ftpmaster.internal/ubuntu bionic-proposed/universe ppc64el hevea all 2.30-1 [883 kB] Get:123 http://ftpmaster.internal/ubuntu bionic/main ppc64el libdatrie1 ppc64el 0.2.10-5 [17.0 kB] Get:124 http://ftpmaster.internal/ubuntu bionic/main ppc64el libglib2.0-bin ppc64el 2.54.1-1ubuntu1 [74.0 kB] Get:125 http://ftpmaster.internal/ubuntu bionic/main ppc64el libglib2.0-dev-bin ppc64el 2.54.1-1ubuntu1 [86.9 kB] Get:126 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpcre16-3 ppc64el 2:8.39-5ubuntu3 [145 kB] Get:127 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpcre32-3 ppc64el 2:8.39-5ubuntu3 [135 kB] Get:128 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpcrecpp0v5 ppc64el 2:8.39-5ubuntu3 [16.5 kB] Get:129 http://ftpmaster.internal/ubuntu bionic/main ppc64el libpcre3-dev ppc64el 2:8.39-5ubuntu3 [518 kB] Get:130 http://ftpmaster.internal/ubuntu bionic/main ppc64el pkg-config ppc64el 0.29.1-0ubuntu2 [44.1 kB] Get:131 http://ftpmaster.internal/ubuntu bionic/main ppc64el zlib1g-dev ppc64el 1:1.2.11.dfsg-0ubuntu2 [178 kB] Get:132 http://ftpmaster.internal/ubuntu bionic/main ppc64el libglib2.0-dev ppc64el 2.54.1-1ubuntu1 [1628 kB] Get:133 http://ftpmaster.internal/ubuntu bionic/universe ppc64el libmime-charset-perl all 1.012-2 [30.8 kB] Get:134 http://ftpmaster.internal/ubuntu bionic/main ppc64el libthai-data all 0.1.26-3 [132 kB] Get:135 http://ftpmaster.internal/ubuntu bionic-proposed/main ppc64el libthai0 ppc64el 0.1.27-1 [17.9 kB] Get:136 http://ftpmaster.internal/ubuntu bionic/universe ppc64el libsombok3 ppc64el 2.4.0-1 [26.9 kB] Get:137 http://ftpmaster.internal/ubuntu bionic/universe ppc64el libunicode-linebreak-perl ppc64el 0.0.20160702-1build2 [94.7 kB] Get:138 http://ftpmaster.internal/ubuntu bionic/main ppc64el texlive-latex-base all 2017.20170818-1 [946 kB] Get:139 http://ftpmaster.internal/ubuntu bionic/universe ppc64el texlive-extra-utils all 2017.20170818-1 [20.3 MB] debconf: delaying package configuration, since apt-utils is not installed Fetched 103 MB in 7s (14.6 MB/s) (Reading database ... 12543 files and directories currently installed.) Removing pkg-create-dbgsym (0.73) ... Selecting previously unselected package libpython3.6-minimal:ppc64el. (Reading database ... 12534 files and directories currently installed.) Preparing to unpack .../0-libpython3.6-minimal_3.6.3-1ubuntu1_ppc64el.deb ... Unpacking libpython3.6-minimal:ppc64el (3.6.3-1ubuntu1) ... Selecting previously unselected package libexpat1:ppc64el. Preparing to unpack .../1-libexpat1_2.2.3-1_ppc64el.deb ... Unpacking libexpat1:ppc64el (2.2.3-1) ... Selecting previously unselected package python3.6-minimal. Preparing to unpack .../2-python3.6-minimal_3.6.3-1ubuntu1_ppc64el.deb ... Unpacking python3.6-minimal (3.6.3-1ubuntu1) ... Selecting previously unselected package python3-minimal. Preparing to unpack .../3-python3-minimal_3.6.3-2_ppc64el.deb ... Unpacking python3-minimal (3.6.3-2) ... Selecting previously unselected package mime-support. Preparing to unpack .../4-mime-support_3.60ubuntu1_all.deb ... Unpacking mime-support (3.60ubuntu1) ... Selecting previously unselected package libmpdec2:ppc64el. Preparing to unpack .../5-libmpdec2_2.4.2-1_ppc64el.deb ... Unpacking libmpdec2:ppc64el (2.4.2-1) ... Selecting previously unselected package libpython3.6-stdlib:ppc64el. Preparing to unpack .../6-libpython3.6-stdlib_3.6.3-1ubuntu1_ppc64el.deb ... Unpacking libpython3.6-stdlib:ppc64el (3.6.3-1ubuntu1) ... Selecting previously unselected package python3.6. Preparing to unpack .../7-python3.6_3.6.3-1ubuntu1_ppc64el.deb ... Unpacking python3.6 (3.6.3-1ubuntu1) ... Selecting previously unselected package libpython3-stdlib:ppc64el. Preparing to unpack .../8-libpython3-stdlib_3.6.3-2_ppc64el.deb ... Unpacking libpython3-stdlib:ppc64el (3.6.3-2) ... Selecting previously unselected package dh-python. Preparing to unpack .../9-dh-python_2.20170125_all.deb ... Unpacking dh-python (2.20170125) ... Setting up libpython3.6-minimal:ppc64el (3.6.3-1ubuntu1) ... Setting up libexpat1:ppc64el (2.2.3-1) ... Setting up python3.6-minimal (3.6.3-1ubuntu1) ... Setting up python3-minimal (3.6.3-2) ... Selecting previously unselected package python3. (Reading database ... 13494 files and directories currently installed.) Preparing to unpack .../00-python3_3.6.3-2_ppc64el.deb ... Unpacking python3 (3.6.3-2) ... Selecting previously unselected package libxau6:ppc64el. Preparing to unpack .../01-libxau6_1%3a1.0.8-1_ppc64el.deb ... Unpacking libxau6:ppc64el (1:1.0.8-1) ... Selecting previously unselected package libbsd0:ppc64el. Preparing to unpack .../02-libbsd0_0.8.6-2_ppc64el.deb ... Unpacking libbsd0:ppc64el (0.8.6-2) ... Selecting previously unselected package libxdmcp6:ppc64el. Preparing to unpack .../03-libxdmcp6_1%3a1.1.2-3_ppc64el.deb ... Unpacking libxdmcp6:ppc64el (1:1.1.2-3) ... Selecting previously unselected package libxcb1:ppc64el. Preparing to unpack .../04-libxcb1_1.12-1ubuntu1_ppc64el.deb ... Unpacking libxcb1:ppc64el (1.12-1ubuntu1) ... Selecting previously unselected package libx11-data. Preparing to unpack .../05-libx11-data_2%3a1.6.4-3_all.deb ... Unpacking libx11-data (2:1.6.4-3) ... Selecting previously unselected package libx11-6:ppc64el. Preparing to unpack .../06-libx11-6_2%3a1.6.4-3_ppc64el.deb ... Unpacking libx11-6:ppc64el (2:1.6.4-3) ... Selecting previously unselected package libxext6:ppc64el. Preparing to unpack .../07-libxext6_2%3a1.3.3-1_ppc64el.deb ... Unpacking libxext6:ppc64el (2:1.3.3-1) ... Selecting previously unselected package groff-base. Preparing to unpack .../08-groff-base_1.22.3-9_ppc64el.deb ... Unpacking groff-base (1.22.3-9) ... Selecting previously unselected package bsdmainutils. Preparing to unpack .../09-bsdmainutils_9.0.12+nmu1ubuntu1_ppc64el.deb ... Unpacking bsdmainutils (9.0.12+nmu1ubuntu1) ... Selecting previously unselected package libpipeline1:ppc64el. Preparing to unpack .../10-libpipeline1_1.4.2-1_ppc64el.deb ... Unpacking libpipeline1:ppc64el (1.4.2-1) ... Selecting previously unselected package man-db. Preparing to unpack .../11-man-db_2.7.6.1-2_ppc64el.deb ... Unpacking man-db (2.7.6.1-2) ... Selecting previously unselected package libjpeg-turbo8:ppc64el. Preparing to unpack .../12-libjpeg-turbo8_1.5.2-0ubuntu5_ppc64el.deb ... Unpacking libjpeg-turbo8:ppc64el (1.5.2-0ubuntu5) ... Selecting previously unselected package x11-common. Preparing to unpack .../13-x11-common_1%3a7.7+19ubuntu3_all.deb ... Unpacking x11-common (1:7.7+19ubuntu3) ... Selecting previously unselected package libice6:ppc64el. Preparing to unpack .../14-libice6_2%3a1.0.9-2_ppc64el.deb ... Unpacking libice6:ppc64el (2:1.0.9-2) ... Selecting previously unselected package libsm6:ppc64el. Preparing to unpack .../15-libsm6_2%3a1.2.2-1_ppc64el.deb ... Unpacking libsm6:ppc64el (2:1.2.2-1) ... Selecting previously unselected package poppler-data. Preparing to unpack .../16-poppler-data_0.4.8-1_all.deb ... Unpacking poppler-data (0.4.8-1) ... Selecting previously unselected package libpython2.7-minimal:ppc64el. Preparing to unpack .../17-libpython2.7-minimal_2.7.14-2ubuntu2_ppc64el.deb ... Unpacking libpython2.7-minimal:ppc64el (2.7.14-2ubuntu2) ... Selecting previously unselected package python2.7-minimal. Preparing to unpack .../18-python2.7-minimal_2.7.14-2ubuntu2_ppc64el.deb ... Unpacking python2.7-minimal (2.7.14-2ubuntu2) ... Selecting previously unselected package python-minimal. Preparing to unpack .../19-python-minimal_2.7.14-2ubuntu1_ppc64el.deb ... Unpacking python-minimal (2.7.14-2ubuntu1) ... Selecting previously unselected package libpython2.7-stdlib:ppc64el. Preparing to unpack .../20-libpython2.7-stdlib_2.7.14-2ubuntu2_ppc64el.deb ... Unpacking libpython2.7-stdlib:ppc64el (2.7.14-2ubuntu2) ... Selecting previously unselected package python2.7. Preparing to unpack .../21-python2.7_2.7.14-2ubuntu2_ppc64el.deb ... Unpacking python2.7 (2.7.14-2ubuntu2) ... Selecting previously unselected package libpython-stdlib:ppc64el. Preparing to unpack .../22-libpython-stdlib_2.7.14-2ubuntu1_ppc64el.deb ... Unpacking libpython-stdlib:ppc64el (2.7.14-2ubuntu1) ... Setting up libpython2.7-minimal:ppc64el (2.7.14-2ubuntu2) ... Setting up python2.7-minimal (2.7.14-2ubuntu2) ... Setting up python-minimal (2.7.14-2ubuntu1) ... Selecting previously unselected package python. (Reading database ... 15612 files and directories currently installed.) Preparing to unpack .../000-python_2.7.14-2ubuntu1_ppc64el.deb ... Unpacking python (2.7.14-2ubuntu1) ... Selecting previously unselected package sgml-base. Preparing to unpack .../001-sgml-base_1.29_all.deb ... Unpacking sgml-base (1.29) ... Selecting previously unselected package ucf. Preparing to unpack .../002-ucf_3.0036_all.deb ... Moving old data out of the way Unpacking ucf (3.0036) ... Selecting previously unselected package tex-common. Preparing to unpack .../003-tex-common_6.09_all.deb ... Unpacking tex-common (6.09) ... Selecting previously unselected package libjbig0:ppc64el. Preparing to unpack .../004-libjbig0_2.1-3.1_ppc64el.deb ... Unpacking libjbig0:ppc64el (2.1-3.1) ... Selecting previously unselected package libmagic-mgc. Preparing to unpack .../005-libmagic-mgc_1%3a5.32-1_ppc64el.deb ... Unpacking libmagic-mgc (1:5.32-1) ... Selecting previously unselected package libmagic1:ppc64el. Preparing to unpack .../006-libmagic1_1%3a5.32-1_ppc64el.deb ... Unpacking libmagic1:ppc64el (1:5.32-1) ... Selecting previously unselected package file. Preparing to unpack .../007-file_1%3a5.32-1_ppc64el.deb ... Unpacking file (1:5.32-1) ... Selecting previously unselected package libdbus-1-3:ppc64el. Preparing to unpack .../008-libdbus-1-3_1.12.0-1ubuntu1_ppc64el.deb ... Unpacking libdbus-1-3:ppc64el (1.12.0-1ubuntu1) ... Selecting previously unselected package libelf1:ppc64el. Preparing to unpack .../009-libelf1_0.170-0.1_ppc64el.deb ... Unpacking libelf1:ppc64el (0.170-0.1) ... Selecting previously unselected package libglib2.0-0:ppc64el. Preparing to unpack .../010-libglib2.0-0_2.54.1-1ubuntu1_ppc64el.deb ... Unpacking libglib2.0-0:ppc64el (2.54.1-1ubuntu1) ... Selecting previously unselected package libglib2.0-data. Preparing to unpack .../011-libglib2.0-data_2.54.1-1ubuntu1_all.deb ... Unpacking libglib2.0-data (2.54.1-1ubuntu1) ... Selecting previously unselected package libicu59:ppc64el. Preparing to unpack .../012-libicu59_59.1-3ubuntu1_ppc64el.deb ... Unpacking libicu59:ppc64el (59.1-3ubuntu1) ... Selecting previously unselected package libxml2:ppc64el. Preparing to unpack .../013-libxml2_2.9.4+dfsg1-5ubuntu1_ppc64el.deb ... Unpacking libxml2:ppc64el (2.9.4+dfsg1-5ubuntu1) ... Selecting previously unselected package gettext-base. Preparing to unpack .../014-gettext-base_0.19.8.1-4ubuntu1_ppc64el.deb ... Unpacking gettext-base (0.19.8.1-4ubuntu1) ... Selecting previously unselected package libsigsegv2:ppc64el. Preparing to unpack .../015-libsigsegv2_2.11-1_ppc64el.deb ... Unpacking libsigsegv2:ppc64el (2.11-1) ... Selecting previously unselected package m4. Preparing to unpack .../016-m4_1.4.18-1_ppc64el.deb ... Unpacking m4 (1.4.18-1) ... Selecting previously unselected package autoconf. Preparing to unpack .../017-autoconf_2.69-11_all.deb ... Unpacking autoconf (2.69-11) ... Selecting previously unselected package autotools-dev. Preparing to unpack .../018-autotools-dev_20161112.1+nmu1_all.deb ... Unpacking autotools-dev (20161112.1+nmu1) ... Selecting previously unselected package automake. Preparing to unpack .../019-automake_1%3a1.15.1-3ubuntu1_all.deb ... Unpacking automake (1:1.15.1-3ubuntu1) ... Selecting previously unselected package autopoint. Preparing to unpack .../020-autopoint_0.19.8.1-4ubuntu1_all.deb ... Unpacking autopoint (0.19.8.1-4ubuntu1) ... Selecting previously unselected package libtool. Preparing to unpack .../021-libtool_2.4.6-2_all.deb ... Unpacking libtool (2.4.6-2) ... Selecting previously unselected package dh-autoreconf. Preparing to unpack .../022-dh-autoreconf_14_all.deb ... Unpacking dh-autoreconf (14) ... Selecting previously unselected package libarchive-zip-perl. Preparing to unpack .../023-libarchive-zip-perl_1.59-1_all.deb ... Unpacking libarchive-zip-perl (1.59-1) ... Selecting previously unselected package libfile-stripnondeterminism-perl. Preparing to unpack .../024-libfile-stripnondeterminism-perl_0.039-1_all.deb ... Unpacking libfile-stripnondeterminism-perl (0.039-1) ... Selecting previously unselected package libtimedate-perl. Preparing to unpack .../025-libtimedate-perl_2.3000-2_all.deb ... Unpacking libtimedate-perl (2.3000-2) ... Selecting previously unselected package dh-strip-nondeterminism. Preparing to unpack .../026-dh-strip-nondeterminism_0.039-1_all.deb ... Unpacking dh-strip-nondeterminism (0.039-1) ... Selecting previously unselected package libcroco3:ppc64el. Preparing to unpack .../027-libcroco3_0.6.12-1_ppc64el.deb ... Unpacking libcroco3:ppc64el (0.6.12-1) ... Selecting previously unselected package gettext. Preparing to unpack .../028-gettext_0.19.8.1-4ubuntu1_ppc64el.deb ... Unpacking gettext (0.19.8.1-4ubuntu1) ... Selecting previously unselected package intltool-debian. Preparing to unpack .../029-intltool-debian_0.35.0+20060710.4_all.deb ... Unpacking intltool-debian (0.35.0+20060710.4) ... Selecting previously unselected package po-debconf. Preparing to unpack .../030-po-debconf_1.0.20_all.deb ... Unpacking po-debconf (1.0.20) ... Selecting previously unselected package debhelper. Preparing to unpack .../031-debhelper_10.10.5ubuntu1_all.deb ... Unpacking debhelper (10.10.5ubuntu1) ... Selecting previously unselected package xml-core. Preparing to unpack .../032-xml-core_0.17_all.deb ... Unpacking xml-core (0.17) ... Selecting previously unselected package sgml-data. Preparing to unpack .../033-sgml-data_2.0.10_all.deb ... Unpacking sgml-data (2.0.10) ... Selecting previously unselected package docbook. Preparing to unpack .../034-docbook_4.5-6_all.deb ... Unpacking docbook (4.5-6) ... Selecting previously unselected package libosp5. Preparing to unpack .../035-libosp5_1.5.2-13ubuntu2_ppc64el.deb ... Unpacking libosp5 (1.5.2-13ubuntu2) ... Selecting previously unselected package opensp. Preparing to unpack .../036-opensp_1.5.2-13ubuntu2_ppc64el.deb ... Unpacking opensp (1.5.2-13ubuntu2) ... Selecting previously unselected package docbook-to-man. Preparing to unpack .../037-docbook-to-man_1%3a2.0.0-40_ppc64el.deb ... Unpacking docbook-to-man (1:2.0.0-40) ... Selecting previously unselected package fonts-dejavu-core. Preparing to unpack .../038-fonts-dejavu-core_2.37-1_all.deb ... Unpacking fonts-dejavu-core (2.37-1) ... Selecting previously unselected package fontconfig-config. Preparing to unpack .../039-fontconfig-config_2.12.6-0ubuntu1_all.deb ... Unpacking fontconfig-config (2.12.6-0ubuntu1) ... Selecting previously unselected package fonts-lmodern. Preparing to unpack .../040-fonts-lmodern_2.004.5-3_all.deb ... Unpacking fonts-lmodern (2.004.5-3) ... Selecting previously unselected package libavahi-common-data:ppc64el. Preparing to unpack .../041-libavahi-common-data_0.6.32-1ubuntu1_ppc64el.deb ... Unpacking libavahi-common-data:ppc64el (0.6.32-1ubuntu1) ... Selecting previously unselected package libavahi-common3:ppc64el. Preparing to unpack .../042-libavahi-common3_0.6.32-1ubuntu1_ppc64el.deb ... Unpacking libavahi-common3:ppc64el (0.6.32-1ubuntu1) ... Selecting previously unselected package libavahi-client3:ppc64el. Preparing to unpack .../043-libavahi-client3_0.6.32-1ubuntu1_ppc64el.deb ... Unpacking libavahi-client3:ppc64el (0.6.32-1ubuntu1) ... Selecting previously unselected package libcups2:ppc64el. Preparing to unpack .../044-libcups2_2.2.5-2_ppc64el.deb ... Unpacking libcups2:ppc64el (2.2.5-2) ... Selecting previously unselected package libcupsimage2:ppc64el. Preparing to unpack .../045-libcupsimage2_2.2.5-2_ppc64el.deb ... Unpacking libcupsimage2:ppc64el (2.2.5-2) ... Selecting previously unselected package libfreetype6:ppc64el. Preparing to unpack .../046-libfreetype6_2.8-0.2ubuntu2_ppc64el.deb ... Unpacking libfreetype6:ppc64el (2.8-0.2ubuntu2) ... Selecting previously unselected package libfontconfig1:ppc64el. Preparing to unpack .../047-libfontconfig1_2.12.6-0ubuntu1_ppc64el.deb ... Unpacking libfontconfig1:ppc64el (2.12.6-0ubuntu1) ... Selecting previously unselected package libijs-0.35:ppc64el. Preparing to unpack .../048-libijs-0.35_0.35-12_ppc64el.deb ... Unpacking libijs-0.35:ppc64el (0.35-12) ... Selecting previously unselected package libjbig2dec0:ppc64el. Preparing to unpack .../049-libjbig2dec0_0.13-5_ppc64el.deb ... Unpacking libjbig2dec0:ppc64el (0.13-5) ... Selecting previously unselected package libjpeg8:ppc64el. Preparing to unpack .../050-libjpeg8_8c-2ubuntu8_ppc64el.deb ... Unpacking libjpeg8:ppc64el (8c-2ubuntu8) ... Selecting previously unselected package liblcms2-2:ppc64el. Preparing to unpack .../051-liblcms2-2_2.7-1ubuntu1_ppc64el.deb ... Unpacking liblcms2-2:ppc64el (2.7-1ubuntu1) ... Selecting previously unselected package libpaper1:ppc64el. Preparing to unpack .../052-libpaper1_1.1.24+nmu5ubuntu1_ppc64el.deb ... Unpacking libpaper1:ppc64el (1.1.24+nmu5ubuntu1) ... Selecting previously unselected package libtiff5:ppc64el. Preparing to unpack .../053-libtiff5_4.0.8-6_ppc64el.deb ... Unpacking libtiff5:ppc64el (4.0.8-6) ... Selecting previously unselected package libgs9-common. Preparing to unpack .../054-libgs9-common_9.21~dfsg+1-0ubuntu3_all.deb ... Unpacking libgs9-common (9.21~dfsg+1-0ubuntu3) ... Selecting previously unselected package libgs9:ppc64el. Preparing to unpack .../055-libgs9_9.21~dfsg+1-0ubuntu3_ppc64el.deb ... Unpacking libgs9:ppc64el (9.21~dfsg+1-0ubuntu3) ... Selecting previously unselected package ghostscript. Preparing to unpack .../056-ghostscript_9.21~dfsg+1-0ubuntu3_ppc64el.deb ... Unpacking ghostscript (9.21~dfsg+1-0ubuntu3) ... Selecting previously unselected package libnetpbm10. Preparing to unpack .../057-libnetpbm10_2%3a10.0-15.3build1_ppc64el.deb ... Unpacking libnetpbm10 (2:10.0-15.3build1) ... Selecting previously unselected package netpbm. Preparing to unpack .../058-netpbm_2%3a10.0-15.3build1_ppc64el.deb ... Unpacking netpbm (2:10.0-15.3build1) ... Selecting previously unselected package libpaper-utils. Preparing to unpack .../059-libpaper-utils_1.1.24+nmu5ubuntu1_ppc64el.deb ... Unpacking libpaper-utils (1.1.24+nmu5ubuntu1) ... Selecting previously unselected package libkpathsea6:ppc64el. Preparing to unpack .../060-libkpathsea6_2017.20170613.44572-6_ppc64el.deb ... Unpacking libkpathsea6:ppc64el (2017.20170613.44572-6) ... Selecting previously unselected package libptexenc1:ppc64el. Preparing to unpack .../061-libptexenc1_2017.20170613.44572-6_ppc64el.deb ... Unpacking libptexenc1:ppc64el (2017.20170613.44572-6) ... Selecting previously unselected package libsynctex1:ppc64el. Preparing to unpack .../062-libsynctex1_2017.20170613.44572-6_ppc64el.deb ... Unpacking libsynctex1:ppc64el (2017.20170613.44572-6) ... Selecting previously unselected package libtexlua52:ppc64el. Preparing to unpack .../063-libtexlua52_2017.20170613.44572-6_ppc64el.deb ... Unpacking libtexlua52:ppc64el (2017.20170613.44572-6) ... Selecting previously unselected package t1utils. Preparing to unpack .../064-t1utils_1.41-1_ppc64el.deb ... Unpacking t1utils (1.41-1) ... Selecting previously unselected package libpixman-1-0:ppc64el. Preparing to unpack .../065-libpixman-1-0_0.34.0-1_ppc64el.deb ... Unpacking libpixman-1-0:ppc64el (0.34.0-1) ... Selecting previously unselected package libxcb-render0:ppc64el. Preparing to unpack .../066-libxcb-render0_1.12-1ubuntu1_ppc64el.deb ... Unpacking libxcb-render0:ppc64el (1.12-1ubuntu1) ... Selecting previously unselected package libxcb-shm0:ppc64el. Preparing to unpack .../067-libxcb-shm0_1.12-1ubuntu1_ppc64el.deb ... Unpacking libxcb-shm0:ppc64el (1.12-1ubuntu1) ... Selecting previously unselected package libxrender1:ppc64el. Preparing to unpack .../068-libxrender1_1%3a0.9.10-1_ppc64el.deb ... Unpacking libxrender1:ppc64el (1:0.9.10-1) ... Selecting previously unselected package libcairo2:ppc64el. Preparing to unpack .../069-libcairo2_1.15.8-2_ppc64el.deb ... Unpacking libcairo2:ppc64el (1.15.8-2) ... Selecting previously unselected package libgraphite2-3:ppc64el. Preparing to unpack .../070-libgraphite2-3_1.3.10-6_ppc64el.deb ... Unpacking libgraphite2-3:ppc64el (1.3.10-6) ... Selecting previously unselected package libharfbuzz0b:ppc64el. Preparing to unpack .../071-libharfbuzz0b_1.6.2-1_ppc64el.deb ... Unpacking libharfbuzz0b:ppc64el (1.6.2-1) ... Selecting previously unselected package libharfbuzz-icu0:ppc64el. Preparing to unpack .../072-libharfbuzz-icu0_1.6.2-1_ppc64el.deb ... Unpacking libharfbuzz-icu0:ppc64el (1.6.2-1) ... Selecting previously unselected package libnspr4:ppc64el. Preparing to unpack .../073-libnspr4_2%3a4.16-1ubuntu2_ppc64el.deb ... Unpacking libnspr4:ppc64el (2:4.16-1ubuntu2) ... Selecting previously unselected package libnss3:ppc64el. Preparing to unpack .../074-libnss3_2%3a3.32-1ubuntu3_ppc64el.deb ... Unpacking libnss3:ppc64el (2:3.32-1ubuntu3) ... Selecting previously unselected package libpoppler68:ppc64el. Preparing to unpack .../075-libpoppler68_0.57.0-2ubuntu4_ppc64el.deb ... Unpacking libpoppler68:ppc64el (0.57.0-2ubuntu4) ... Selecting previously unselected package libpotrace0. Preparing to unpack .../076-libpotrace0_1.14-2_ppc64el.deb ... Unpacking libpotrace0 (1.14-2) ... Selecting previously unselected package libxt6:ppc64el. Preparing to unpack .../077-libxt6_1%3a1.1.5-1_ppc64el.deb ... Unpacking libxt6:ppc64el (1:1.1.5-1) ... Selecting previously unselected package libxmu6:ppc64el. Preparing to unpack .../078-libxmu6_2%3a1.1.2-2_ppc64el.deb ... Unpacking libxmu6:ppc64el (2:1.1.2-2) ... Selecting previously unselected package libxpm4:ppc64el. Preparing to unpack .../079-libxpm4_1%3a3.5.12-1_ppc64el.deb ... Unpacking libxpm4:ppc64el (1:3.5.12-1) ... Selecting previously unselected package libxaw7:ppc64el. Preparing to unpack .../080-libxaw7_2%3a1.0.13-1_ppc64el.deb ... Unpacking libxaw7:ppc64el (2:1.0.13-1) ... Selecting previously unselected package libxi6:ppc64el. Preparing to unpack .../081-libxi6_2%3a1.7.9-1_ppc64el.deb ... Unpacking libxi6:ppc64el (2:1.7.9-1) ... Selecting previously unselected package libzzip-0-13:ppc64el. Preparing to unpack .../082-libzzip-0-13_0.13.62-3.1_ppc64el.deb ... Unpacking libzzip-0-13:ppc64el (0.13.62-3.1) ... Selecting previously unselected package texlive-binaries. Preparing to unpack .../083-texlive-binaries_2017.20170613.44572-6_ppc64el.deb ... Unpacking texlive-binaries (2017.20170613.44572-6) ... Selecting previously unselected package xdg-utils. Preparing to unpack .../084-xdg-utils_1.1.1-1ubuntu3_all.deb ... Unpacking xdg-utils (1.1.1-1ubuntu3) ... Selecting previously unselected package texlive-base. Preparing to unpack .../085-texlive-base_2017.20170818-1_all.deb ... Unpacking texlive-base (2017.20170818-1) ... Selecting previously unselected package ocaml-base-nox. Preparing to unpack .../086-ocaml-base-nox_4.05.0-10ubuntu1_ppc64el.deb ... Unpacking ocaml-base-nox (4.05.0-10ubuntu1) ... Selecting previously unselected package hevea. Preparing to unpack .../087-hevea_2.30-1_all.deb ... Unpacking hevea (2.30-1) ... Selecting previously unselected package libdatrie1:ppc64el. Preparing to unpack .../088-libdatrie1_0.2.10-5_ppc64el.deb ... Unpacking libdatrie1:ppc64el (0.2.10-5) ... Selecting previously unselected package libglib2.0-bin. Preparing to unpack .../089-libglib2.0-bin_2.54.1-1ubuntu1_ppc64el.deb ... Unpacking libglib2.0-bin (2.54.1-1ubuntu1) ... Selecting previously unselected package libglib2.0-dev-bin. Preparing to unpack .../090-libglib2.0-dev-bin_2.54.1-1ubuntu1_ppc64el.deb ... Unpacking libglib2.0-dev-bin (2.54.1-1ubuntu1) ... Selecting previously unselected package libpcre16-3:ppc64el. Preparing to unpack .../091-libpcre16-3_2%3a8.39-5ubuntu3_ppc64el.deb ... Unpacking libpcre16-3:ppc64el (2:8.39-5ubuntu3) ... Selecting previously unselected package libpcre32-3:ppc64el. Preparing to unpack .../092-libpcre32-3_2%3a8.39-5ubuntu3_ppc64el.deb ... Unpacking libpcre32-3:ppc64el (2:8.39-5ubuntu3) ... Selecting previously unselected package libpcrecpp0v5:ppc64el. Preparing to unpack .../093-libpcrecpp0v5_2%3a8.39-5ubuntu3_ppc64el.deb ... Unpacking libpcrecpp0v5:ppc64el (2:8.39-5ubuntu3) ... Selecting previously unselected package libpcre3-dev:ppc64el. Preparing to unpack .../094-libpcre3-dev_2%3a8.39-5ubuntu3_ppc64el.deb ... Unpacking libpcre3-dev:ppc64el (2:8.39-5ubuntu3) ... Selecting previously unselected package pkg-config. Preparing to unpack .../095-pkg-config_0.29.1-0ubuntu2_ppc64el.deb ... Unpacking pkg-config (0.29.1-0ubuntu2) ... Selecting previously unselected package zlib1g-dev:ppc64el. Preparing to unpack .../096-zlib1g-dev_1%3a1.2.11.dfsg-0ubuntu2_ppc64el.deb ... Unpacking zlib1g-dev:ppc64el (1:1.2.11.dfsg-0ubuntu2) ... Selecting previously unselected package libglib2.0-dev:ppc64el. Preparing to unpack .../097-libglib2.0-dev_2.54.1-1ubuntu1_ppc64el.deb ... Unpacking libglib2.0-dev:ppc64el (2.54.1-1ubuntu1) ... Selecting previously unselected package libmime-charset-perl. Preparing to unpack .../098-libmime-charset-perl_1.012-2_all.deb ... Unpacking libmime-charset-perl (1.012-2) ... Selecting previously unselected package libthai-data. Preparing to unpack .../099-libthai-data_0.1.26-3_all.deb ... Unpacking libthai-data (0.1.26-3) ... Selecting previously unselected package libthai0:ppc64el. Preparing to unpack .../100-libthai0_0.1.27-1_ppc64el.deb ... Unpacking libthai0:ppc64el (0.1.27-1) ... Selecting previously unselected package libsombok3:ppc64el. Preparing to unpack .../101-libsombok3_2.4.0-1_ppc64el.deb ... Unpacking libsombok3:ppc64el (2.4.0-1) ... Selecting previously unselected package libunicode-linebreak-perl. Preparing to unpack .../102-libunicode-linebreak-perl_0.0.20160702-1build2_ppc64el.deb ... Unpacking libunicode-linebreak-perl (0.0.20160702-1build2) ... Selecting previously unselected package texlive-latex-base. Preparing to unpack .../103-texlive-latex-base_2017.20170818-1_all.deb ... Unpacking texlive-latex-base (2017.20170818-1) ... Selecting previously unselected package texlive-extra-utils. Preparing to unpack .../104-texlive-extra-utils_2017.20170818-1_all.deb ... Unpacking texlive-extra-utils (2017.20170818-1) ... Selecting previously unselected package sbuild-build-depends-wise-dummy. Preparing to unpack .../105-sbuild-build-depends-wise-dummy_0.invalid.0_ppc64el.deb ... Unpacking sbuild-build-depends-wise-dummy (0.invalid.0) ... Setting up libgs9-common (9.21~dfsg+1-0ubuntu3) ... Setting up libkpathsea6:ppc64el (2017.20170613.44572-6) ... Setting up libtexlua52:ppc64el (2017.20170613.44572-6) ... Setting up libsynctex1:ppc64el (2017.20170613.44572-6) ... Setting up libptexenc1:ppc64el (2017.20170613.44572-6) ... Setting up libarchive-zip-perl (1.59-1) ... Setting up mime-support (3.60ubuntu1) ... Setting up libtimedate-perl (2.3000-2) ... Setting up liblcms2-2:ppc64el (2.7-1ubuntu1) ... Setting up libjbig0:ppc64el (2.1-3.1) ... Setting up libsigsegv2:ppc64el (2.11-1) ... Setting up fonts-dejavu-core (2.37-1) ... Setting up poppler-data (0.4.8-1) ... Setting up libicu59:ppc64el (59.1-3ubuntu1) ... Setting up libelf1:ppc64el (0.170-0.1) ... Setting up groff-base (1.22.3-9) ... Setting up libglib2.0-0:ppc64el (2.54.1-1ubuntu1) ... No schema files found: doing nothing. Setting up libnetpbm10 (2:10.0-15.3build1) ... Setting up ocaml-base-nox (4.05.0-10ubuntu1) ... Setting up libosp5 (1.5.2-13ubuntu2) ... Setting up libdatrie1:ppc64el (0.2.10-5) ... Setting up gettext-base (0.19.8.1-4ubuntu1) ... Setting up libjpeg-turbo8:ppc64el (1.5.2-0ubuntu5) ... Setting up libpipeline1:ppc64el (1.4.2-1) ... Setting up m4 (1.4.18-1) ... Setting up sgml-base (1.29) ... Setting up libbsd0:ppc64el (0.8.6-2) ... Setting up libnspr4:ppc64el (2:4.16-1ubuntu2) ... Setting up ucf (3.0036) ... Setting up libxml2:ppc64el (2.9.4+dfsg1-5ubuntu1) ... Setting up libfreetype6:ppc64el (2.8-0.2ubuntu2) ... Setting up libmagic-mgc (1:5.32-1) ... Setting up libmagic1:ppc64el (1:5.32-1) ... Setting up libgraphite2-3:ppc64el (1.3.10-6) ... Setting up libcroco3:ppc64el (0.6.12-1) ... Setting up pkg-config (0.29.1-0ubuntu2) ... Setting up libjbig2dec0:ppc64el (0.13-5) ... Setting up libpixman-1-0:ppc64el (0.34.0-1) ... Setting up libmime-charset-perl (1.012-2) ... Setting up libglib2.0-data (2.54.1-1ubuntu1) ... Processing triggers for libc-bin (2.26-0ubuntu2) ... Setting up autotools-dev (20161112.1+nmu1) ... Setting up t1utils (1.41-1) ... Processing triggers for systemd (235-2ubuntu1) ... Setting up libijs-0.35:ppc64el (0.35-12) ... Setting up libpotrace0 (1.14-2) ... Setting up libpcrecpp0v5:ppc64el (2:8.39-5ubuntu3) ... Setting up libpcre32-3:ppc64el (2:8.39-5ubuntu3) ... Setting up libpcre16-3:ppc64el (2:8.39-5ubuntu3) ... Setting up libthai-data (0.1.26-3) ... Setting up libxdmcp6:ppc64el (1:1.1.2-3) ... Setting up xml-core (0.17) ... Setting up bsdmainutils (9.0.12+nmu1ubuntu1) ... update-alternatives: using /usr/bin/bsd-write to provide /usr/bin/write (write) in auto mode update-alternatives: using /usr/bin/bsd-from to provide /usr/bin/from (from) in auto mode Setting up libzzip-0-13:ppc64el (0.13.62-3.1) ... Setting up x11-common (1:7.7+19ubuntu3) ... update-rc.d: warning: start and stop actions are no longer supported; falling back to defaults Running in chroot, ignoring request. invoke-rc.d: policy-rc.d denied execution of start. Setting up xdg-utils (1.1.1-1ubuntu3) ... Setting up libglib2.0-bin (2.54.1-1ubuntu1) ... Setting up libx11-data (2:1.6.4-3) ... Setting up libpython2.7-stdlib:ppc64el (2.7.14-2ubuntu2) ... Setting up libxau6:ppc64el (1:1.0.8-1) ... Setting up autopoint (0.19.8.1-4ubuntu1) ... Setting up libmpdec2:ppc64el (2.4.2-1) ... Setting up libdbus-1-3:ppc64el (1.12.0-1ubuntu1) ... Setting up fonts-lmodern (2.004.5-3) ... Setting up libavahi-common-data:ppc64el (0.6.32-1ubuntu1) ... Setting up zlib1g-dev:ppc64el (1:1.2.11.dfsg-0ubuntu2) ... Setting up libfile-stripnondeterminism-perl (0.039-1) ... Setting up libjpeg8:ppc64el (8c-2ubuntu8) ... Setting up libpaper1:ppc64el (1.1.24+nmu5ubuntu1) ... Creating config file /etc/papersize with new version Setting up libpython3.6-stdlib:ppc64el (3.6.3-1ubuntu1) ... Setting up libpaper-utils (1.1.24+nmu5ubuntu1) ... Setting up libpcre3-dev:ppc64el (2:8.39-5ubuntu3) ... Setting up fontconfig-config (2.12.6-0ubuntu1) ... Setting up python3.6 (3.6.3-1ubuntu1) ... Setting up opensp (1.5.2-13ubuntu2) ... Setting up tex-common (6.09) ... update-language: texlive-base not installed and configured, doing nothing! Setting up gettext (0.19.8.1-4ubuntu1) ... Setting up python2.7 (2.7.14-2ubuntu2) ... Setting up libnss3:ppc64el (2:3.32-1ubuntu3) ... Setting up libharfbuzz0b:ppc64el (1.6.2-1) ... Setting up libtiff5:ppc64el (4.0.8-6) ... Setting up autoconf (2.69-11) ... Setting up libthai0:ppc64el (0.1.27-1) ... Setting up file (1:5.32-1) ... Setting up libpython-stdlib:ppc64el (2.7.14-2ubuntu1) ... Setting up intltool-debian (0.35.0+20060710.4) ... Setting up automake (1:1.15.1-3ubuntu1) ... update-alternatives: using /usr/bin/automake-1.15 to provide /usr/bin/automake (automake) in auto mode Setting up netpbm (2:10.0-15.3build1) ... Setting up libice6:ppc64el (2:1.0.9-2) ... Setting up man-db (2.7.6.1-2) ... Not building database; man-db/auto-update is not 'true'. Setting up libavahi-common3:ppc64el (0.6.32-1ubuntu1) ... Setting up libxcb1:ppc64el (1.12-1ubuntu1) ... Setting up python (2.7.14-2ubuntu1) ... Setting up libsombok3:ppc64el (2.4.0-1) ... Setting up libtool (2.4.6-2) ... Setting up libpython3-stdlib:ppc64el (3.6.3-2) ... Setting up libfontconfig1:ppc64el (2.12.6-0ubuntu1) ... Setting up libsm6:ppc64el (2:1.2.2-1) ... Setting up libxcb-render0:ppc64el (1.12-1ubuntu1) ... Setting up libharfbuzz-icu0:ppc64el (1.6.2-1) ... Setting up po-debconf (1.0.20) ... Setting up libx11-6:ppc64el (2:1.6.4-3) ... Setting up libunicode-linebreak-perl (0.0.20160702-1build2) ... Setting up libxcb-shm0:ppc64el (1.12-1ubuntu1) ... Setting up libxpm4:ppc64el (1:3.5.12-1) ... Setting up libxt6:ppc64el (1:1.1.5-1) ... Setting up libxrender1:ppc64el (1:0.9.10-1) ... Setting up libavahi-client3:ppc64el (0.6.32-1ubuntu1) ... Setting up libpoppler68:ppc64el (0.57.0-2ubuntu4) ... Setting up libcups2:ppc64el (2.2.5-2) ... Setting up libxext6:ppc64el (2:1.3.3-1) ... Setting up libxmu6:ppc64el (2:1.1.2-2) ... Setting up libcupsimage2:ppc64el (2.2.5-2) ... Setting up libgs9:ppc64el (9.21~dfsg+1-0ubuntu3) ... Setting up libxi6:ppc64el (2:1.7.9-1) ... Setting up libxaw7:ppc64el (2:1.0.13-1) ... Setting up libcairo2:ppc64el (1.15.8-2) ... Setting up ghostscript (9.21~dfsg+1-0ubuntu3) ... Setting up texlive-binaries (2017.20170613.44572-6) ... update-alternatives: using /usr/bin/xdvi-xaw to provide /usr/bin/xdvi.bin (xdvi.bin) in auto mode update-alternatives: using /usr/bin/bibtex.original to provide /usr/bin/bibtex (bibtex) in auto mode Setting up texlive-base (2017.20170818-1) ... /usr/bin/tl-paper: setting paper size for dvips to a4. /usr/bin/tl-paper: setting paper size for dvipdfmx to a4. /usr/bin/tl-paper: setting paper size for xdvi to a4. /usr/bin/tl-paper: setting paper size for pdftex to a4. Setting up texlive-latex-base (2017.20170818-1) ... Setting up texlive-extra-utils (2017.20170818-1) ... Setting up hevea (2.30-1) ... Processing triggers for sgml-base (1.29) ... Setting up sgml-data (2.0.10) ... Processing triggers for sgml-base (1.29) ... Setting up docbook (4.5-6) ... Processing triggers for sgml-base (1.29) ... Setting up docbook-to-man (1:2.0.0-40) ... Setting up dh-python (2.20170125) ... Setting up dh-autoreconf (14) ... Setting up python3 (3.6.3-2) ... Setting up libglib2.0-dev-bin (2.54.1-1ubuntu1) ... Setting up libglib2.0-dev:ppc64el (2.54.1-1ubuntu1) ... Setting up dh-strip-nondeterminism (0.039-1) ... Setting up debhelper (10.10.5ubuntu1) ... Setting up sbuild-build-depends-wise-dummy (0.invalid.0) ... (Reading database ... 24473 files and directories currently installed.) Purging configuration files for pkg-create-dbgsym (0.73) ... Processing triggers for tex-common (6.09) ... Running updmap-sys. This may take some time... done. Running mktexlsr /var/lib/texmf ... done. Building format(s) --all. This may take some time... done. Processing triggers for libc-bin (2.26-0ubuntu2) ... Processing triggers for systemd (235-2ubuntu1) ... +------------------------------------------------------------------------------+ | Build environment | +------------------------------------------------------------------------------+ Kernel: Linux 4.4.0-97-generic ppc64el (ppc64le) Toolchain package versions: binutils_2.29.1-6ubuntu1 dpkg-dev_1.19.0.4ubuntu1 g++-7_7.2.0-12ubuntu1 gcc-7_7.2.0-12ubuntu1 libc6-dev_2.26-0ubuntu2 libstdc++-7-dev_7.2.0-12ubuntu1 libstdc++6_7.2.0-12ubuntu1 linux-libc-dev_4.13.0-16.19 Package versions: adduser_3.113+nmu3ubuntu5 advancecomp_2.0-1 apt_1.6~alpha3 autoconf_2.69-11 automake_1:1.15.1-3ubuntu1 autopoint_0.19.8.1-4ubuntu1 autotools-dev_20161112.1+nmu1 base-files_10ubuntu1 base-passwd_3.5.44 bash_4.4-5ubuntu1 binutils_2.29.1-6ubuntu1 binutils-common_2.29.1-6ubuntu1 binutils-powerpc64le-linux-gnu_2.29.1-6ubuntu1 bsdmainutils_9.0.12+nmu1ubuntu1 bsdutils_1:2.30.1-0ubuntu4 build-essential_12.4ubuntu1 bzip2_1.0.6-8.1 ca-certificates_20170717 coreutils_8.26-3ubuntu4 cpp_4:7.2.0-1ubuntu1 cpp-7_7.2.0-12ubuntu1 dash_0.5.8-2.3ubuntu1 debconf_1.5.64 debhelper_10.10.5ubuntu1 debianutils_4.8.2 dh-autoreconf_14 dh-python_2.20170125 dh-strip-nondeterminism_0.039-1 diffutils_1:3.6-1 dmsetup_2:1.02.137-2ubuntu3 docbook_4.5-6 docbook-to-man_1:2.0.0-40 dpkg_1.19.0.4ubuntu1 dpkg-dev_1.19.0.4ubuntu1 e2fslibs_1.43.7-1 e2fsprogs_1.43.7-1 fakeroot_1.21-1ubuntu2 fdisk_2.30.1-0ubuntu4 file_1:5.32-1 findutils_4.6.0+git+20170729-2 fontconfig-config_2.12.6-0ubuntu1 fonts-dejavu-core_2.37-1 fonts-lmodern_2.004.5-3 g++_4:7.2.0-1ubuntu1 g++-7_7.2.0-12ubuntu1 gcc_4:7.2.0-1ubuntu1 gcc-7_7.2.0-12ubuntu1 gcc-7-base_7.2.0-12ubuntu1 gettext_0.19.8.1-4ubuntu1 gettext-base_0.19.8.1-4ubuntu1 ghostscript_9.21~dfsg+1-0ubuntu3 gnupg_2.1.15-1ubuntu8 gnupg-agent_2.1.15-1ubuntu8 gpgv_2.1.15-1ubuntu8 grep_3.1-2 groff-base_1.22.3-9 gzip_1.6-5ubuntu1 hevea_2.30-1 hostname_3.18 init_1.49ubuntu1 init-system-helpers_1.49ubuntu1 initscripts_2.88dsf-59.3ubuntu2 insserv_1.14.0-5ubuntu3 intltool-debian_0.35.0+20060710.4 libacl1_2.2.52-3build1 libapparmor1_2.11.0-2ubuntu17 libapt-pkg5.0_1.6~alpha3 libarchive-zip-perl_1.59-1 libasan4_7.2.0-12ubuntu1 libasn1-8-heimdal_7.4.0.dfsg.1-2 libassuan0_2.4.3-3 libatomic1_7.2.0-12ubuntu1 libattr1_1:2.4.47-2build1 libaudit-common_1:2.7.7-1ubuntu2 libaudit1_1:2.7.7-1ubuntu2 libavahi-client3_0.6.32-1ubuntu1 libavahi-common-data_0.6.32-1ubuntu1 libavahi-common3_0.6.32-1ubuntu1 libbinutils_2.29.1-6ubuntu1 libblkid1_2.30.1-0ubuntu4 libbsd0_0.8.6-2 libbz2-1.0_1.0.6-8.1 libc-bin_2.26-0ubuntu2 libc-dev-bin_2.26-0ubuntu2 libc6_2.26-0ubuntu2 libc6-dev_2.26-0ubuntu2 libcairo2_1.15.8-2 libcap-ng0_0.7.7-3.1 libcap2_1:2.25-1.1 libcc1-0_7.2.0-12ubuntu1 libcomerr2_1.43.7-1 libcroco3_0.6.12-1 libcryptsetup4_2:1.7.3-4ubuntu1 libcups2_2.2.5-2 libcupsimage2_2.2.5-2 libcurl3-gnutls_7.55.1-1ubuntu2.1 libdatrie1_0.2.10-5 libdb5.3_5.3.28-13.1 libdbus-1-3_1.12.0-1ubuntu1 libdebconfclient0_0.213ubuntu1 libdevmapper1.02.1_2:1.02.137-2ubuntu3 libdpkg-perl_1.19.0.4ubuntu1 libelf1_0.170-0.1 libexpat1_2.2.3-1 libfakeroot_1.21-1ubuntu2 libfdisk1_2.30.1-0ubuntu4 libffi6_3.2.1-6 libfile-stripnondeterminism-perl_0.039-1 libfontconfig1_2.12.6-0ubuntu1 libfreetype6_2.8-0.2ubuntu2 libgcc-7-dev_7.2.0-12ubuntu1 libgcc1_1:7.2.0-12ubuntu1 libgcrypt20_1.7.9-1 libgdbm3_1.8.3-14 libglib2.0-0_2.54.1-1ubuntu1 libglib2.0-bin_2.54.1-1ubuntu1 libglib2.0-data_2.54.1-1ubuntu1 libglib2.0-dev_2.54.1-1ubuntu1 libglib2.0-dev-bin_2.54.1-1ubuntu1 libgmp10_2:6.1.2+dfsg-1.1 libgnutls30_3.5.8-6ubuntu3 libgomp1_7.2.0-12ubuntu1 libgpg-error0_1.27-4 libgraphite2-3_1.3.10-6 libgs9_9.21~dfsg+1-0ubuntu3 libgs9-common_9.21~dfsg+1-0ubuntu3 libgssapi-krb5-2_1.15.1-2 libgssapi3-heimdal_7.4.0.dfsg.1-2 libharfbuzz-icu0_1.6.2-1 libharfbuzz0b_1.6.2-1 libhcrypto4-heimdal_7.4.0.dfsg.1-2 libheimbase1-heimdal_7.4.0.dfsg.1-2 libheimntlm0-heimdal_7.4.0.dfsg.1-2 libhogweed4_3.3-2 libhx509-5-heimdal_7.4.0.dfsg.1-2 libice6_2:1.0.9-2 libicu59_59.1-3ubuntu1 libidn11_1.33-2 libidn2-0_2.0.2-5 libijs-0.35_0.35-12 libip4tc0_1.6.1-2ubuntu1 libisl15_0.18-1 libitm1_7.2.0-12ubuntu1 libjbig0_2.1-3.1 libjbig2dec0_0.13-5 libjpeg-turbo8_1.5.2-0ubuntu5 libjpeg8_8c-2ubuntu8 libk5crypto3_1.15.1-2 libkeyutils1_1.5.9-9.1ubuntu1 libkmod2_24-1ubuntu2 libkpathsea6_2017.20170613.44572-6 libkrb5-26-heimdal_7.4.0.dfsg.1-2 libkrb5-3_1.15.1-2 libkrb5support0_1.15.1-2 libksba8_1.3.5-2 liblcms2-2_2.7-1ubuntu1 libldap-2.4-2_2.4.45+dfsg-1ubuntu1 libldap-common_2.4.45+dfsg-1ubuntu1 liblockfile-bin_1.14-1 liblockfile1_1.14-1 liblsan0_7.2.0-12ubuntu1 liblz4-1_0.0~r131-2ubuntu2 liblzma5_5.2.2-1.3 libmagic-mgc_1:5.32-1 libmagic1_1:5.32-1 libmime-charset-perl_1.012-2 libmount1_2.30.1-0ubuntu4 libmpc3_1.0.3-2 libmpdec2_2.4.2-1 libmpfr4_3.1.6-1 libncurses5_6.0+20160625-1ubuntu1 libncursesw5_6.0+20160625-1ubuntu1 libnetpbm10_2:10.0-15.3build1 libnettle6_3.3-2 libnpth0_1.5-2 libnspr4_2:4.16-1ubuntu2 libnss3_2:3.32-1ubuntu3 libosp5_1.5.2-13ubuntu2 libp11-kit0_0.23.9-2 libpam-modules_1.1.8-3.2ubuntu3 libpam-modules-bin_1.1.8-3.2ubuntu3 libpam-runtime_1.1.8-3.2ubuntu3 libpam0g_1.1.8-3.2ubuntu3 libpaper-utils_1.1.24+nmu5ubuntu1 libpaper1_1.1.24+nmu5ubuntu1 libpcre16-3_2:8.39-5ubuntu3 libpcre3_2:8.39-5ubuntu3 libpcre3-dev_2:8.39-5ubuntu3 libpcre32-3_2:8.39-5ubuntu3 libpcrecpp0v5_2:8.39-5ubuntu3 libperl5.26_5.26.1-2ubuntu1 libpipeline1_1.4.2-1 libpixman-1-0_0.34.0-1 libpng16-16_1.6.34-1 libpoppler68_0.57.0-2ubuntu4 libpotrace0_1.14-2 libprocps6_2:3.3.12-1ubuntu2 libpsl5_0.18.0-4 libptexenc1_2017.20170613.44572-6 libpython-stdlib_2.7.14-2ubuntu1 libpython2.7-minimal_2.7.14-2ubuntu2 libpython2.7-stdlib_2.7.14-2ubuntu2 libpython3-stdlib_3.6.3-2 libpython3.6-minimal_3.6.3-1ubuntu1 libpython3.6-stdlib_3.6.3-1ubuntu1 libreadline7_7.0-0ubuntu2 libroken18-heimdal_7.4.0.dfsg.1-2 librtmp1_2.4+20151223.gitfa8646d.1-1 libsasl2-2_2.1.27~101-g0780600+dfsg-3ubuntu1 libsasl2-modules-db_2.1.27~101-g0780600+dfsg-3ubuntu1 libseccomp2_2.3.1-2.1ubuntu3 libselinux1_2.7-2 libsemanage-common_2.7-2 libsemanage1_2.7-2 libsepol1_2.7-1 libsigsegv2_2.11-1 libslang2_2.3.1-5ubuntu1 libsm6_2:1.2.2-1 libsmartcols1_2.30.1-0ubuntu4 libsombok3_2.4.0-1 libsqlite3-0_3.20.1-2 libss2_1.43.7-1 libssl1.0.0_1.0.2g-1ubuntu13 libstdc++-7-dev_7.2.0-12ubuntu1 libstdc++6_7.2.0-12ubuntu1 libsynctex1_2017.20170613.44572-6 libsystemd0_235-2ubuntu1 libtasn1-6_4.12-2.1 libtexlua52_2017.20170613.44572-6 libthai-data_0.1.26-3 libthai0_0.1.27-1 libtiff5_4.0.8-6 libtimedate-perl_2.3000-2 libtinfo5_6.0+20160625-1ubuntu1 libtool_2.4.6-2 libtsan0_7.2.0-12ubuntu1 libubsan0_7.2.0-12ubuntu1 libudev1_235-2ubuntu1 libunicode-linebreak-perl_0.0.20160702-1build2 libunistring0_0.9.3-5.2ubuntu1 libusb-0.1-4_2:0.1.12-31 libustr-1.0-1_1.0.4-6 libuuid1_2.30.1-0ubuntu4 libwind0-heimdal_7.4.0.dfsg.1-2 libx11-6_2:1.6.4-3 libx11-data_2:1.6.4-3 libxau6_1:1.0.8-1 libxaw7_2:1.0.13-1 libxcb-render0_1.12-1ubuntu1 libxcb-shm0_1.12-1ubuntu1 libxcb1_1.12-1ubuntu1 libxdmcp6_1:1.1.2-3 libxext6_2:1.3.3-1 libxi6_2:1.7.9-1 libxml2_2.9.4+dfsg1-5ubuntu1 libxmu6_2:1.1.2-2 libxpm4_1:3.5.12-1 libxrender1_1:0.9.10-1 libxt6_1:1.1.5-1 libzzip-0-13_0.13.62-3.1 linux-libc-dev_4.13.0-16.19 lockfile-progs_0.1.17build1 login_1:4.2-3.2ubuntu4 lsb-base_9.20160110ubuntu5 m4_1.4.18-1 make_4.1-9.1 man-db_2.7.6.1-2 mawk_1.3.3-17ubuntu2 mime-support_3.60ubuntu1 mount_2.30.1-0ubuntu4 multiarch-support_2.26-0ubuntu2 ncurses-base_6.0+20160625-1ubuntu1 ncurses-bin_6.0+20160625-1ubuntu1 netpbm_2:10.0-15.3build1 ocaml-base-nox_4.05.0-10ubuntu1 opensp_1.5.2-13ubuntu2 openssl_1.0.2g-1ubuntu13 optipng_0.7.6-1build1 passwd_1:4.2-3.2ubuntu4 patch_2.7.5-1build1 perl_5.26.1-2ubuntu1 perl-base_5.26.1-2ubuntu1 perl-modules-5.26_5.26.1-2ubuntu1 pinentry-curses_1.0.0-3 pkg-config_0.29.1-0ubuntu2 pkgbinarymangler_131 po-debconf_1.0.20 policyrcd-script-zg2_0.1-3 poppler-data_0.4.8-1 procps_2:3.3.12-1ubuntu2 python_2.7.14-2ubuntu1 python-minimal_2.7.14-2ubuntu1 python2.7_2.7.14-2ubuntu2 python2.7-minimal_2.7.14-2ubuntu2 python3_3.6.3-2 python3-minimal_3.6.3-2 python3.6_3.6.3-1ubuntu1 python3.6-minimal_3.6.3-1ubuntu1 readline-common_7.0-0ubuntu2 sbuild-build-depends-core-dummy_0.invalid.0 sbuild-build-depends-wise-dummy_0.invalid.0 sed_4.4-1 sensible-utils_0.0.10 sgml-base_1.29 sgml-data_2.0.10 systemd_235-2ubuntu1 systemd-sysv_235-2ubuntu1 sysv-rc_2.88dsf-59.3ubuntu2 sysvinit-utils_2.88dsf-59.8git1 t1utils_1.41-1 tar_1.29b-2 tex-common_6.09 texlive-base_2017.20170818-1 texlive-binaries_2017.20170613.44572-6 texlive-extra-utils_2017.20170818-1 texlive-latex-base_2017.20170818-1 tzdata_2017c-1 ubuntu-keyring_2016.10.27 ucf_3.0036 util-linux_2.30.1-0ubuntu4 x11-common_1:7.7+19ubuntu3 xdg-utils_1.1.1-1ubuntu3 xml-core_0.17 xz-utils_5.2.2-1.3 zlib1g_1:1.2.11.dfsg-0ubuntu2 zlib1g-dev_1:1.2.11.dfsg-0ubuntu2 +------------------------------------------------------------------------------+ | Build | +------------------------------------------------------------------------------+ Unpack source ------------- gpgv: Signature made Fri Sep 22 08:42:14 2017 UTC gpgv: using RSA key gpgv: Can't check signature: No public key dpkg-source: warning: failed to verify signature on ./wise_2.4.1-20.dsc dpkg-source: info: extracting wise in wise-2.4.1 dpkg-source: info: unpacking wise_2.4.1.orig.tar.gz dpkg-source: info: unpacking wise_2.4.1-20.debian.tar.xz dpkg-source: info: applying 01_welcome-csh.patch dpkg-source: info: applying 02_isnumber.patch dpkg-source: info: applying 03_doc-nodycache.patch dpkg-source: info: applying 04_wise2-pdflatex-update.patch dpkg-source: info: applying 05_glib2.patch dpkg-source: info: applying 06_getline.patch dpkg-source: info: applying 07_ld--as-needed.patch dpkg-source: info: applying 08_mayhem.patch dpkg-source: info: applying 09_dnal-add-return-statement.patch dpkg-source: info: applying 10_fix_path_to_data_files.patch dpkg-source: info: applying 11_consistent_manual_dates.patch dpkg-source: info: applying spelling.patch Check disc space ---------------- Sufficient free space for build User Environment ---------------- APT_CONFIG=/var/lib/sbuild/apt.conf DEB_BUILD_OPTIONS=parallel=4 HOME=/sbuild-nonexistent LANG=C.UTF-8 LC_ALL=C.UTF-8 LOGNAME=buildd PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/bin:/usr/games SCHROOT_ALIAS_NAME=build-PACKAGEBUILD-13664339 SCHROOT_CHROOT_NAME=build-PACKAGEBUILD-13664339 SCHROOT_COMMAND=env SCHROOT_GID=2501 SCHROOT_GROUP=buildd SCHROOT_SESSION_ID=build-PACKAGEBUILD-13664339 SCHROOT_UID=2001 SCHROOT_USER=buildd SHELL=/bin/sh TERM=unknown USER=buildd V=1 dpkg-buildpackage ----------------- dpkg-buildpackage: info: source package wise dpkg-buildpackage: info: source version 2.4.1-20 dpkg-buildpackage: info: source distribution unstable dpkg-source --before-build wise-2.4.1 dpkg-buildpackage: info: host architecture ppc64el fakeroot debian/rules clean dh clean dh_auto_clean dh_autoreconf_clean debian/rules override_dh_clean make[1]: Entering directory '/<>' /usr/bin/make -C src clean make[2]: Entering directory '/<>/src' cd external ; /usr/bin/make clean make[3]: Entering directory '/<>/src/external' (cd mott; make clean) make[4]: Entering directory '/<>/src/external/mott' rm -f *.[oa] make[4]: Leaving directory '/<>/src/external/mott' make[3]: Leaving directory '/<>/src/external' if test -d dynlibsrc; then cd dynlibsrc ; rm -f *.[oa]; fi if test -d models; then cd models ; rm -f *.[oa]; fi if test -d base; then cd base ; rm -f *.[oa]; fi if test -d socket; then cd socket ; rm -f *.[oa]; fi if test -d dnaindex; then cd dnaindex ; rm -f *.[oa]; fi if test -d network; then cd network ; rm -f *.[oa]; fi if test -d dyc; then cd dyc ; rm -f *.[oa]; fi if test -d HMMer2; then cd HMMer2 ; rm -f *.[oa]; fi if test -d perl; then cd perl/Wise2/libs ; rm -f *.[oa]; fi if test -x perl/Wise2/Makefile; then cd perl/Wise2/ ; /usr/bin/make clean; fi if test -d oldbin; then rm -rf oldbin; fi if test -d bin; then echo 'moving binaries to oldbin'; mv -f bin oldbin; fi make[2]: Leaving directory '/<>/src' /usr/bin/make -C debian/manpages.d clean make[2]: Entering directory '/<>/debian/manpages.d' rm -f dba.1 dnal.1 estwise.1 estwisedb.1 genewise.1 genewisedb.1 genomewise.1 promoterwise.1 psw.1 pswdb.1 scanwise.1 scanwise_server.1 make[2]: Leaving directory '/<>/debian/manpages.d' rm -f -r src/oldbin for i in dba psw dnal genomewise pswdb scanwise estwise genewise sywise genewisedb promoterwise pseudowise estwisedb; do rm -f src/models/$i; done rm -f src/network/scanwise_server rm -f docs/temp.tex rm -f docs/api.* rm -f docs/wise2.image.tex rm -f docs/*.pdf rm -f docs/*.aux rm -f docs/*.log rm -f docs/*.toc rm -f docs/*.pdf rm -f docs/*.dvi rm -f docs/*.ps rm -f docs/*.4ct rm -f docs/*.4tc rm -f docs/*.css rm -f docs/*.idv rm -f docs/*.lg rm -f docs/*.tmp rm -f docs/*.xref rm -f docs/*.haux rm -f docs/*.htoc rm -f docs/*.html rm -f -r docs/api rm -f -r docs/dynamite rm -f -r docs/wise2 dh_clean rm -f debian/debhelper-build-stamp rm -rf debian/.debhelper/ rm -f -- debian/wise.substvars debian/wise-doc.substvars debian/wise-data.substvars debian/files rm -fr -- debian/wise/ debian/tmp/ debian/wise-doc/ debian/wise-data/ find . \( \( \ \( -path .\*/.git -o -path .\*/.svn -o -path .\*/.bzr -o -path .\*/.hg -o -path .\*/CVS \) -prune -o -type f -a \ \( -name '#*#' -o -name '.*~' -o -name '*~' -o -name DEADJOE \ -o -name '*.orig' -o -name '*.rej' -o -name '*.bak' \ -o -name '.*.orig' -o -name .*.rej -o -name '.SUMS' \ -o -name TAGS -o \( -path '*/.deps/*' -a -name '*.P' \) \ \) -exec rm -f {} + \) -o \ \( -type d -a -name autom4te.cache -prune -exec rm -rf {} + \) \) make[1]: Leaving directory '/<>' debian/rules build-arch dh build-arch dh_update_autotools_config -a dh_autoreconf -a dh_auto_configure -a debian/rules override_dh_auto_build make[1]: Entering directory '/<>' /usr/bin/make -C src all make[2]: Entering directory '/<>/src' (cd base ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libwisebase.a ) make[3]: Entering directory '/<>/src/base' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wiseconfig.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wisestring.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wiseerror.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wisememman.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wisefile.c wisefile.dy: In function ‘Wise2_myfclose’: wisefile.dy:72:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘FILE * {aka struct _IO_FILE *}’ [-Wformat=] fprintf(stderr,"Closing %d\n",ofp); ^~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wiserandom.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wisetime.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wiseoverlay.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include wisestreaminterface.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include commandline.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include linesubs.c ar ru libwisebase.a wiseconfig.o wisestring.o wiseerror.o wisememman.o wisefile.o wiserandom.o wisetime.o wiseoverlay.o wisestreaminterface.o commandline.o linesubs.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libwisebase.a if test -x /bin/ranlib; then /bin/ranlib libwisebase.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libwisebase.a; else exit 0; fi make[3]: Leaving directory '/<>/src/base' (cd HMMer2 ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libhmmer.a ) make[3]: Entering directory '/<>/src/HMMer2' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c alphabet.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c core_algorithms.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c debug.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c emit.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c emulation.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c histogram.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c hmmio.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c mathsupport.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c masks.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c misc.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c modelmakers.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c plan7.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c plan9.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c prior.c prior.c: In function ‘P7ReadPrior’: prior.c:102:12: warning: implicit declaration of function ‘strcmp’ [-Wimplicit-function-declaration] if (strcmp(sptr, "DIRICHLET") == 0) pri->strategy = PRI_DCHLET; ^~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c tophits.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c trace.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c aligneval.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c alignio.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c cluster.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c dayhoff.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c file.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c getopt.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c gnuregex.c gnuregex.c: In function ‘re_match_2’: gnuregex.c:3752:31: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] if ((int) old_regend[r] >= (int) regstart[r]) ^ gnuregex.c:3752:54: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] if ((int) old_regend[r] >= (int) regstart[r]) ^ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (lowest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:3758:19: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (p1 + mcnt, d, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (highest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:3758:19: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (p1 + mcnt, d, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (lowest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:3905:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (p + mcnt, NULL, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (highest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:3905:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (p + mcnt, NULL, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (lowest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:3958:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (p + mcnt, d, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (highest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:3958:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (p + mcnt, d, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2482:14: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] high_reg = (unsigned) POP_FAILURE_ITEM (); \ ^ gnuregex.c:4064:13: note: in expansion of macro ‘POP_FAILURE_POINT’ POP_FAILURE_POINT (sdummy, pdummy, ^~~~~~~~~~~~~~~~~ gnuregex.c:2485:13: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] low_reg = (unsigned) POP_FAILURE_ITEM (); \ ^ gnuregex.c:4064:13: note: in expansion of macro ‘POP_FAILURE_POINT’ POP_FAILURE_POINT (sdummy, pdummy, ^~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (lowest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:4097:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (0, 0, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (highest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:4097:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (0, 0, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2394:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (lowest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:4110:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (0, 0, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2315:42: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] fail_stack.stack[fail_stack.avail++] = (fail_stack_elt_t) item ^ gnuregex.c:2397:5: note: in expansion of macro ‘PUSH_FAILURE_ITEM’ PUSH_FAILURE_ITEM (highest_active_reg); \ ^~~~~~~~~~~~~~~~~ gnuregex.c:4110:11: note: in expansion of macro ‘PUSH_FAILURE_POINT’ PUSH_FAILURE_POINT (0, 0, -2); ^~~~~~~~~~~~~~~~~~ gnuregex.c:2482:14: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] high_reg = (unsigned) POP_FAILURE_ITEM (); \ ^ gnuregex.c:4278:11: note: in expansion of macro ‘POP_FAILURE_POINT’ POP_FAILURE_POINT (d, p, ^~~~~~~~~~~~~~~~~ gnuregex.c:2485:13: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] low_reg = (unsigned) POP_FAILURE_ITEM (); \ ^ gnuregex.c:4278:11: note: in expansion of macro ‘POP_FAILURE_POINT’ POP_FAILURE_POINT (d, p, ^~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c interleaved.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c iupac.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c msf.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c revcomp.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c selex.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c sqerror.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c sqio.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c sre_ctype.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c sre_math.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c sre_string.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c stack.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c translate.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c types.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -c weight.c ar rcv libhmmer.a alphabet.o core_algorithms.o debug.o emit.o emulation.o histogram.o hmmio.o mathsupport.o masks.o misc.o modelmakers.o plan7.o plan9.o prior.o tophits.o trace.o aligneval.o alignio.o cluster.o dayhoff.o file.o getopt.o gnuregex.o interleaved.o iupac.o msf.o revcomp.o selex.o sqerror.o sqio.o sre_ctype.o sre_math.o sre_string.o stack.o translate.o types.o weight.o a - alphabet.o a - core_algorithms.o a - debug.o a - emit.o a - emulation.o a - histogram.o a - hmmio.o a - mathsupport.o a - masks.o a - misc.o a - modelmakers.o a - plan7.o a - plan9.o a - prior.o a - tophits.o a - trace.o a - aligneval.o a - alignio.o a - cluster.o a - dayhoff.o a - file.o a - getopt.o a - gnuregex.o a - interleaved.o a - iupac.o a - msf.o a - revcomp.o a - selex.o a - sqerror.o a - sqio.o a - sre_ctype.o a - sre_math.o a - sre_string.o a - stack.o a - translate.o a - types.o a - weight.o if test -x /bin/ranlib; then /bin/ranlib libhmmer.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libhmmer.a; else exit 0; fi if test -x ranlib; then ranlib libhmmer.a; else exit 0; fi chmod 644 libhmmer.a make[3]: Leaving directory '/<>/src/HMMer2' (cd dynlibsrc ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libdyna.a ) make[3]: Entering directory '/<>/src/dynlibsrc' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ packaln.c packaln.dy: In function ‘Wise2_read_simple_PackAln’: packaln.dy:88:3: warning: ignoring return value of ‘fgets’, declared with attribute warn_unused_result [-Wunused-result] fgets(buffer,MAXLINE,ifp); ^~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ aln.c aln.dy: In function ‘Wise2_mapped_ascii_AlnBlock’: aln.dy:867:19: warning: too many arguments for format [-Wformat-extra-args] fprintf(ofp," {%3.2f} ",(double)(*score_to_double)(cuml),cuml); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dnamatrix.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ probability.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ alnrange.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ alnconvert.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ basematrix.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ shattermatrix.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ matrixdebug.c matrixdebug.dy: In function ‘Wise2_user_DebugMatrix’: matrixdebug.dy:208:5: warning: ignoring return value of ‘fgets’, declared with attribute warn_unused_result [-Wunused-result] fgets(buffer,MAXLINE,in); ^~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dpenvelope.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dbsearchimpl.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dprunimpl.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ complexsequence.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ complexevalset.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ complexconsensi.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ sequence.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ sequencestream.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ seqalign.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hitlist.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hsp.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hspstream.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ codon.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ compmat.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ codonmatrix.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ codonmapper.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ sequencedb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hscore.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ seqlookup.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ arrayseqlookup.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ genericindexresult.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ linkedlist_lookpos.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ singlenumberspace.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ histogram.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ searchstatinterface.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ searchstatlookup.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ proteindb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ protein.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ pairbase.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ pairbaseseq.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ genomicdb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ randommodel.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ randomdb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ genomic.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ cdna.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ cdnadb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dna.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ embl.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ genomicregion.c genomicregion.dy: In function ‘Wise2_read_EMBL_FT_into_GenomicRegion’: genomicregion.dy:756:3: warning: ignoring return value of ‘fgets’, declared with attribute warn_unused_result [-Wunused-result] fgets(buffer,maxlen,ifp); ^~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ gene.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ transcript.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ translation.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ btcanvas.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ asciibtcanvas.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dynlibcross.c ar ru libdyna.a packaln.o aln.o dnamatrix.o probability.o alnrange.o alnconvert.o basematrix.o shattermatrix.o matrixdebug.o dpenvelope.o dbsearchimpl.o dprunimpl.o complexsequence.o complexevalset.o complexconsensi.o sequence.o sequencestream.o seqalign.o hitlist.o hsp.o hspstream.o codon.o compmat.o codonmatrix.o codonmapper.o sequencedb.o hscore.o seqlookup.o arrayseqlookup.o genericindexresult.o linkedlist_lookpos.o singlenumberspace.o histogram.o searchstatinterface.o searchstatlookup.o proteindb.o protein.o pairbase.o pairbaseseq.o genomicdb.o randommodel.o randomdb.o genomic.o cdna.o cdnadb.o dna.o embl.o genomicregion.o gene.o transcript.o translation.o btcanvas.o asciibtcanvas.o dynlibcross.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libdyna.a if test -x /bin/ranlib; then /bin/ranlib libdyna.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libdyna.a; else exit 0; fi make[3]: Leaving directory '/<>/src/dynlibsrc' (cd dynlibsrc ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libdyna_glib.a ) make[3]: Entering directory '/<>/src/dynlibsrc' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ subseqhash.c subseqhash.dy: In function ‘Wise2_is_populated_subseqhash_ghash’: subseqhash.dy:111:29: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] if( g_hash_table_lookup(h,(gconstpointer)seq_number) == NULL ) { ^ subseqhash.dy: In function ‘Wise2_lookup_subseqhash_ghash’: subseqhash.dy:128:85: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] return new_linkedl_SeqLookupResultInterface((SeqLookupPos *)g_hash_table_lookup(h,(gconstpointer)seq_number)); ^ subseqhash.dy: In function ‘Wise2_add_seq_subseqhash_ghash’: subseqhash.dy:160:54: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] if((ret = (SeqLookupPos *) g_hash_table_lookup(h,(gconstpointer)seq_number)) == NULL ) { ^ subseqhash.dy:161:29: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] g_hash_table_insert(h,(gpointer)seq_number,p); ^ subseqhash.dy: In function ‘Wise2_add_direct_number_subseqhash_ghash’: subseqhash.dy:188:52: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] if((ret = (SeqLookupPos *) g_hash_table_lookup(h,(gconstpointer)seq_number)) == NULL ) { ^ subseqhash.dy:189:27: warning: cast to pointer from integer of different size [-Wint-to-pointer-cast] g_hash_table_insert(h,(gpointer)seq_number,p); ^ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ intallocator.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ proteinstreamedindex.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ shadowseq.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ shadowseqindex.c shadowseqindex.dy: In function ‘Wise2_dump_stats_ShadowSequenceIndex’: shadowseqindex.dy:285:15: warning: format ‘%f’ expects argument of type ‘double’, but argument 4 has type ‘long unsigned int’ [-Wformat=] fprintf(ofp,"Head memory %d [%.2f Mbytes]\n",total_head,(total_head*sizeof(ShadowArraySeqHead))/100000); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hsphandler.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hspscaninterface.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hsp2hitscan.c hsp2hitscan.dy: In function ‘Wise2_one_off_two_hit_HSPscan_query_direct’: hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t {aka long int}’ [-Wformat=] fprintf(stderr,"START %d.%03du %d.%03ds \n", ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ use.ru_utime.tv_sec, ~~~~~~~~~~~~~~~~~~~ hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:209:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t {aka long int}’ [-Wformat=] fprintf(stderr,"END OF SEED %d.%03du %d.%03ds \n", ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ use.ru_utime.tv_sec, ~~~~~~~~~~~~~~~~~~~ hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:273:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t {aka long int}’ [-Wformat=] fprintf(stderr,"POPULATION %d.%03du %d.%03ds \n", ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ use.ru_utime.tv_sec, ~~~~~~~~~~~~~~~~~~~ hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:286:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘__time_t {aka long int}’ [-Wformat=] fprintf(stdout,"LINEARISED %d.%03du %d.%03ds \n", ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ use.ru_utime.tv_sec, ~~~~~~~~~~~~~~~~~~~ hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 5 has type ‘__time_t {aka long int}’ [-Wformat=] hsp2hitscan.dy:302:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 6 has type ‘__time_t {aka long int}’ [-Wformat=] cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hsplookupscan.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hsplookupthreaded.c hsplookupthreaded.dy: In function ‘Wise2_one_off_ordered_HSPscan_scan_query_direct’: hsplookupthreaded.dy:263:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘long int’ [-Wformat=] fprintf(stderr,"retrieved array with %d elements\n",current_oph); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hspthreadeddb.c hspthreadeddb.dy: In function ‘Wise2_threadeddb_scan_worker’: hspthreadeddb.dy:154:77: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] fprintf(stderr,"For segment %d, finished query with %d (%d) linear\n",seg,(int)seg->lm,seg->lm->len); ^ hspthreadeddb.dy:154:18: warning: format ‘%d’ expects argument of type ‘int’, but argument 3 has type ‘Wise2_HSPDatabaseSegment * {aka struct Wise2_HSPDatabaseSegment *}’ [-Wformat=] fprintf(stderr,"For segment %d, finished query with %d (%d) linear\n",seg,(int)seg->lm,seg->lm->len); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hspscanruntime.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ hsptwohitscan.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ proteinindexcons.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ dnaindexcons.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ staticseq.c ar ru libdyna_glib.a subseqhash.o intallocator.o proteinstreamedindex.o shadowseq.o shadowseqindex.o hsphandler.o hspscaninterface.o hsp2hitscan.o hsplookupscan.o hsplookupthreaded.o hspthreadeddb.o hspscanruntime.o hsptwohitscan.o proteinindexcons.o dnaindexcons.o staticseq.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libdyna_glib.a if test -x /bin/ranlib; then /bin/ranlib libdyna_glib.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libdyna_glib.a; else exit 0; fi make[3]: Leaving directory '/<>/src/dynlibsrc' (cd external ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/external' (cd mott; make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include" all) make[4]: Entering directory '/<>/src/external/mott' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -Wdate-time -D_FORTIFY_SOURCE=2 -c -o mott_api.o mott_api.c mott_api.c: In function ‘InitPvaluesMott’: mott_api.c:64:3: warning: implicit declaration of function ‘free’ [-Wimplicit-function-declaration] free(freq0); ^~~~ mott_api.c:64:3: warning: incompatible implicit declaration of built-in function ‘free’ mott_api.c:64:3: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘SW_PValueMott’: mott_api.c:104:7: warning: incompatible implicit declaration of built-in function ‘free’ free(freqA); ^~~~ mott_api.c:104:7: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘KarlinAltschulStatistics2’: mott_api.c:144:5: warning: incompatible implicit declaration of built-in function ‘free’ free(h+hmin); ^~~~ mott_api.c:144:5: note: include ‘’ or provide a declaration of ‘free’ mott_api.c:155:5: warning: incompatible implicit declaration of built-in function ‘free’ free(h+hmin); ^~~~ mott_api.c:155:5: note: include ‘’ or provide a declaration of ‘free’ mott_api.c: In function ‘GetHistogram’: mott_api.c:179:16: warning: implicit declaration of function ‘calloc’ [-Wimplicit-function-declaration] h = (double*)calloc(*hmax-*hmin+1,sizeof(double))-*hmin; ^~~~~~ mott_api.c:179:16: warning: incompatible implicit declaration of built-in function ‘calloc’ mott_api.c:179:16: note: include ‘’ or provide a declaration of ‘calloc’ mott_api.c: In function ‘PseudoResidueFrequencies2’: mott_api.c:207:12: warning: implicit declaration of function ‘toupper’ [-Wimplicit-function-declaration] freq[toupper(seq[n])]++; ^~~~~~~ mott_api.c: In function ‘RobinsonResidueFrequencies2’: mott_api.c:230:27: warning: incompatible implicit declaration of built-in function ‘calloc’ double *freq = (double*)calloc(256, sizeof(double)); ^~~~~~ mott_api.c:230:27: note: include ‘’ or provide a declaration of ‘calloc’ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -Wdate-time -D_FORTIFY_SOURCE=2 -c -o gaplib.o gaplib.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../../dynlibsrc -I../../base wise2_mott_bridge.c ar ru libmott.a mott_api.o gaplib.o wise2_mott_bridge.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libmott.a if test -x /bin/ranlib; then /bin/ranlib libmott.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libmott.a; else exit 0; fi make[4]: Leaving directory '/<>/src/external/mott' make[3]: Leaving directory '/<>/src/external' (cd socket ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" libwisesocket.a ) make[3]: Entering directory '/<>/src/socket' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ functionserver.c functionserver.dy: In function ‘Wise2_main_loop_forking_FunctionServer’: functionserver.dy:129:4: warning: ignoring return value of ‘write’, declared with attribute warn_unused_result [-Wunused-result] write(new_socket,buf,9); ^~~~~~~~~~~~~~~~~~~~~~~ functionserver.dy:141:2: warning: ignoring return value of ‘write’, declared with attribute warn_unused_result [-Wunused-result] write(new_socket,buf,6); ^~~~~~~~~~~~~~~~~~~~~~~ functionserver.dy:183:2: warning: ignoring return value of ‘write’, declared with attribute warn_unused_result [-Wunused-result] write(new_socket,buf,5); ^~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ functionclient.c functionclient.dy: In function ‘Wise2_new_FunctionProxyCoordinator’: functionclient.dy:193:24: warning: passing argument 2 of ‘connect’ from incompatible pointer type [-Wincompatible-pointer-types] connect(out->socket, &server, sizeof(server)); ^ In file included from functionclient.c:7:0: /usr/include/powerpc64le-linux-gnu/sys/socket.h:126:12: note: expected ‘const struct sockaddr *’ but argument is of type ‘struct sockaddr_in *’ extern int connect (int __fd, __CONST_SOCKADDR_ARG __addr, socklen_t __len); ^~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ anonobj.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ transferinterface.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ directsocketwrite.c ar ru libwisesocket.a functionserver.o functionclient.o anonobj.o transferinterface.o directsocketwrite.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libwisesocket.a if test -x /bin/ranlib; then /bin/ranlib libwisesocket.a; else exit 0; fi if test -x /usr/bin/ranlib; then /usr/bin/ranlib libwisesocket.a; else exit 0; fi make[3]: Leaving directory '/<>/src/socket' (cd dnaindex ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/dnaindex' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly.c kmer_assembly.dy: In function ‘Wise2_show_KmerAssemblyNode’: kmer_assembly.dy:296:15: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(ofp,"Node %ld of sequence %s \n",node->number,buffer); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ kmer_assembly.dy:302:17: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(ofp," ... prev ... %c, %d to %ld\n",node->prev[i]->base,node->prev[i]->sequence_label_len,node->prev[i]->prev->number); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ kmer_assembly.dy:309:17: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 5 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(ofp," ... next ... %c, %d to %ld\n",node->next[i]->base,node->next[i]->sequence_label_len,node->next[i]->next->number); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ kmer_assembly.dy: In function ‘Wise2_remove_sequence_label_KmerAssemblyLink’: kmer_assembly.dy:365:18: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘KmerAssemblyLink * {aka struct KmerAssemblyLink *}’ [-Wformat=] fprintf(stderr," ...unable to remove label %ld from link %ld (%d labels)\n",label,kal,kal->sequence_label_len); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ kmer_assembly.dy:367:20: warning: format ‘%d’ expects a matching ‘int’ argument [-Wformat=] fprintf(stderr," [%ld] is %d label\n",kal->sequence_label[i]); ^~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_index_interface.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_direct.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_hash.c kmer_hash.dy: In function ‘Wise2_free_KmerHashIndex’: kmer_hash.dy:318:19: warning: format ‘%lx’ expects argument of type ‘long unsigned int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr, "min_kmer: %016lx\n", khi->min_kmer); ^~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ kmer_hash.dy:319:19: warning: format ‘%lx’ expects argument of type ‘long unsigned int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr, "max_kmer: %016lx\n", khi->max_kmer); ^~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_count.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_glib_index.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models singleseqspace.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models dnamapping.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models largeseqreader.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_untangler.c kmer_assembly_untangler.dy: In function ‘Wise2_show_KmerAssemblyPath’: kmer_assembly_untangler.dy:52:65: warning: cast from pointer to integer of different size [-Wpointer-to-int-cast] fprintf(ofp,"%3d memory %d, from [%s] to [%s], base %c\n",i,(int)kap->stack[i],back,forw,kap->stack[i]->base); ^ kmer_assembly_untangler.dy: In function ‘Wise2_untangle_KmerAssembly’: kmer_assembly_untangler.dy:120:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"TANGLE: Node %ld, %s has forward %d and back %d links\n",node->number,buffer,node->next_len,node->prev_len); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ kmer_assembly_untangler.dy:141:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"Will attempt untangle starting at %ld to %ld\n",node->prev[i]->prev->number,node->number); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ kmer_assembly_untangler.dy:141:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 4 has type ‘kmer_t {aka long long int}’ [-Wformat=] kmer_assembly_untangler.dy:157:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"RESOLVED: Node %ld [%s] Fully untangled now...\n",node->number,buffer); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ kmer_assembly_untangler.dy:159:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"UNRESOLVED: Node %ld [%s] still tangled...\n",node->number,buffer); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ kmer_assembly_untangler.dy: In function ‘Wise2_old_attempt_forward_untangle_KmerAssembly’: kmer_assembly_untangler.dy:444:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"looking at node %ld with path length %d, next length %d depth %d\n",current->next->number,pathlen,current->next->next_len,current->sequence_label_len); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~ kmer_assembly_untangler.dy:568:75: warning: passing argument 4 of ‘Wise2_lift_backward_tangled_tail’ from incompatible pointer type [-Wincompatible-pointer-types] lift_backward_tangled_tail(kai,newpath->stack[newpath->stack_len-1],path,transferred_label,transferred_pos,transferred_len); ^~~~~~~~~~~~~~~~~ In file included from kmer_assembly_untangler.c:4:0: kmer_assembly_untangler.h:174:6: note: expected ‘int *’ but argument is of type ‘long int *’ void Wise2_lift_backward_tangled_tail(KmerAssemblyIndex * kai,KmerAssemblyLink * new,KmerAssemblyPath * tail,int * start_label,SinglePosSequence ** positions,int label_len); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ kmer_assembly_untangler.dy: In function ‘Wise2_lift_forward_tangled_KmerAssemblyPath’: kmer_assembly_untangler.dy:746:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 6 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"Moving stack position %d, depth %d, transfer %d, between %ld [%s] and %ld [%s]\n",i,kap->stack[i]->sequence_label_len,label_len,kap->stack[i]->prev->number,back,kap->stack[i]->next->number,forw); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~~~~~~~~~~~~~~~~ kmer_assembly_untangler.dy:746:20: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 8 has type ‘kmer_t {aka long long int}’ [-Wformat=] cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_contig.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models kmer_assembly_error.c kmer_assembly_error.dy: In function ‘Wise2_mark_tangles_KmerAssembly’: kmer_assembly_error.dy:93:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"Marking node (%ld) [%s] as next tangled\n",node->number,buffer); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ kmer_assembly_error.dy:105:22: warning: format ‘%ld’ expects argument of type ‘long int’, but argument 3 has type ‘kmer_t {aka long long int}’ [-Wformat=] fprintf(stderr,"Marking node (%ld) [%s] as prev tangled\n",node->number,buffer); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ~~~~~~~~~~~~ kmer_assembly_error.dy: In function ‘Wise2_extend_indel_path_KmerAssembly’: kmer_assembly_error.dy:351:17: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘int *’ [-Wformat=] fprintf(stderr,"in considering indel (%d, path %d), real (%c) and error (%c) do not agree at position %d,%d\n",delete_length,current_path,real->base,error->base,real_pos,error_pos); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_interface.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_fasta.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_sanger_project.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models assembly_stream_cons.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -I../models compressed_protein_index.c compressed_protein_index.dy: In function ‘Wise2_add_direct_number_CompressedProteinIndex’: compressed_protein_index.dy:223:10: warning: return makes integer from pointer without a cast [-Wint-conversion] return NULL; ^~~~ make[3]: Leaving directory '/<>/src/dnaindex' (cd network ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" all ) make[3]: Entering directory '/<>/src/network' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex wise_proteinindex_server.c wise_proteinindex_server.c: In function ‘show_version’: wise_proteinindex_server.c:28:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex net_hspscan.c cc -g -o scanwise_server wise_proteinindex_server.o net_hspscan.o ../dnaindex/compressed_protein_index.o ../dnaindex/kmer_index_interface.o ../dnaindex/singleseqspace.o ../dnaindex/kmer_direct.o -ldyna_glib -ldyna -lwisesocket -lwisebase -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -g -L../base/ -L../socket -L../dynlibsrc -L../dnaindex -lm `pkg-config --libs glib-2.0` -lpthread cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../socket -I../dynlibsrc -I../dnaindex client_multihspscan.c make[3]: Leaving directory '/<>/src/network' (cd models ; /usr/bin/make CC="cc" CFLAGS="-g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c `pkg-config --cflags glib-2.0`" EXTRALIBS="-lm" HMMER_DEFINE="HMMER_INTERNAL" HMMER_INCLUDE="../HMMer2/" HMMER_LIBS="../HMMer2/" all ) make[3]: Entering directory '/<>/src/models' cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dnal.c dnal.c: In function ‘show_version’: dnal.c:106:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dnaalign.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ seqaligndisplay.c cc -o dnal dnal.o dnaalign.o seqaligndisplay.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ psw.c psw.c: In function ‘show_version’: psw.c:261:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ proteinsw.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ sw_wrap.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ abc.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pba.c cc -o psw psw.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pswdb.c pswdb.c: In function ‘show_version’: pswdb.c:97:106: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(stdout,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -o pswdb pswdb.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dbac.c dbac.c: In function ‘show_version’: dbac.c:364:33: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp," Compiled %s\n",COMPILE_DATE); ^~~~~~~~~~~~ dbac.c: In function ‘make_SeqAlign_from_align’: dbac.c:413:32: warning: format ‘%d’ expects argument of type ‘int’, but argument 4 has type ‘size_t {aka long unsigned int}’ [-Wformat=] fprintf(stderr,"Got %d with %d vs %d\n",i,strlen(seq),one->len); ~^ ~~~~~~~~~~~ %ld cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dba.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ slimdba.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ bigdba.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ dbadisplay.c cc -o dba dbac.o dba.o slimdba.o bigdba.o dbadisplay.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include estwise.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ -I. estwise.c: In function ‘show_version’: estwise.c:559:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparser21.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparameter.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genestats.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisehsp.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneutil.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneoutput.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ threestatemodel.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genefrequency.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ splicesitemodeler.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise4.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise6.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genestretch6.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewise21.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneloop21.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneloop6.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genephase6.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwlite.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwlitemodel.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwrap.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ matchsum.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estwrap.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisemodel.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ phasemodel.c phasemodel.dy: In function ‘Wise2_read_fasta_PhasedProtein’: phasemodel.dy:241:3: warning: ignoring return value of ‘fgets’, declared with attribute warn_unused_result [-Wunused-result] fgets(name,10000,ifp); ^~~~~~~~~~~~~~~~~~~~~ In file included from /usr/include/stdio.h:862:0, from ../base/wisebase.h:6, from ../dynlibsrc/probability.h:7, from geneparser21.h:6, from genewisemodel.h:6, from phasemodel.h:6, from phasemodel.c:4: In function ‘fgets’, inlined from ‘Wise2_read_fasta_PhasedProtein’ at phasemodel.dy:241:3: /usr/include/powerpc64le-linux-gnu/bits/stdio2.h:260:9: warning: call to ‘__fgets_chk_warn’ declared with attribute warning: fgets called with bigger size than length of destination buffer return __fgets_chk_warn (__s, __bos (__s), __n, __stream); ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ cdparser.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genedisplay.c genedisplay.dy: In function ‘Wise2_write_intron_desc’: genedisplay.dy:493:20: warning: too many arguments for format [-Wformat-extra-args] sprintf(buffer," Intron ??? ",in_number); ^~~~~~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estwise3.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estslim3.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estloop3.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estfrag3.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estslimloop.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ gwquickdb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ threestatedb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pfamhmmer1db.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pwmdna.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../HMMer2/ -DHMMER_INTERNAL -I../base/ -I../dynlibsrc/ wise2xhmmer2.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genewisemodeldb.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ seqhit.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ standardout.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ geneparser4.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ estquick3.c cc -g -o estwise estwise.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include genewise.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ -I. genewise.c: In function ‘show_version’: genewise.c:860:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -o genewise genewise.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna_glib -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include genewisedb.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ genewisedb.c: In function ‘show_version’: genewisedb.c:1005:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -o genewisedb genewisedb.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include estwisedb.c -I../base/ -I../dynlibsrc/ -I../HMMer2/ estwisedb.c: In function ‘show_version’: estwisedb.c:838:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -o estwisedb estwisedb.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genomewise.c genomewise.c: In function ‘show_version’: genomewise.c:18:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genomewise9.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ genome_evidence.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ est_evidence.c est_evidence.dy: In function ‘Wise2_new_est_GenomeEvidenceUnit’: est_evidence.dy:142:16: warning: assignment from incompatible pointer type [-Wincompatible-pointer-types] in->geu_free = free_EstEvidence; ^ cc -g -o genomewise genomewise.o genomewise9.o genome_evidence.o est_evidence.o geneoutput.o geneutil.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ sywise.c sywise.c: In function ‘show_version’: sywise.c:14:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ sywise20.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ syexonmodel.c cc -g -o sywise sywise.o sywise20.o syexonmodel.o genestats.o pwmdna.o standardout.o geneutil.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pseudowise.c pseudowise.c: In function ‘show_version’: pseudowise.c:15:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pseudowise7.c cc -g -o pseudowise pseudowise.o pseudowise7.o geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -lhmmer -ldyna_glib -ldyna -lwisebase -lm -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ `pkg-config --cflags glib-2.0` promoterwise.c promoterwise.c: In function ‘show_version’: promoterwise.c:17:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ localdba.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ `pkg-config --cflags glib-2.0` localcishit.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ localcispara.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ motifmatrix.c motifmatrix.c: In function ‘Wise2_MotifConsMatrix_alloc_matrix’: motifmatrix.c:408:24: warning: assignment makes integer from pointer without a cast [-Wint-conversion] for(i=0;i>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ motifmatrixdp.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ transfactor.c cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ pairwiseshortdna.c cc -g -o promoterwise promoterwise.o localdba.o localcishit.o localcispara.o dbadisplay.o motifmatrix.o motifmatrixdp.o transfactor.o pwmdna.o pairwiseshortdna.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -ldyna_glib -ldyna -lwisebase -lm `pkg-config --libs glib-2.0` -lpthread cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ -o scanwisep_wiseserver.o -DSCAN_WISESERVER -I../network -I../socket -I../external/mott scanwisep.c scanwisep.c: In function ‘show_version’: scanwisep.c:423:103: warning: macro "__DATE__" might prevent reproducible builds [-Wdate-time] fprintf(ofp,"%s\nVersion: %s\nReleased: %s\nCompiled: %s\n",program_name,VERSION_NUMBER,RELEASE_DAY,COMPILE_DATE); ^~~~~~~~~~~~ cc -g -O3 -fdebug-prefix-map=/<>=. -fstack-protector-strong -Wformat -Werror=format-security -Wdate-time -D_FORTIFY_SOURCE=2 -c -I/usr/include/glib-2.0 -I/usr/lib/powerpc64le-linux-gnu/glib-2.0/include -I../base/ -I../dynlibsrc/ `pkg-config --cflags glib-2.0` hsp2aln_sw.c cc -o scanwise scanwisep_wiseserver.o sw_wrap.o seqaligndisplay.o proteinsw.o abc.o pba.o hsp2aln_sw.o ../network/net_hspscan.o ../network/client_multihspscan.o -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` -L../external/mott -L../socket -lmott -ldyna_glib -ldyna -lwisesocket -lwisebase -lm -lpthread -Wl,-Bsymbolic-functions -Wl,-z,relro -Wl,-z,now -L../base/ -L../dynlibsrc/ -L../HMMer2/ -lpthread `pkg-config --libs glib-2.0` ar ru libmodel.a geneparser21.o geneparameter.o genestats.o genewisehsp.o geneutil.o geneoutput.o threestatemodel.o genefrequency.o splicesitemodeler.o genewise4.o genewise6.o genestretch6.o genewise21.o geneloop21.o geneloop6.o genephase6.o gwlite.o gwlitemodel.o gwrap.o matchsum.o estwrap.o genewisemodel.o phasemodel.o cdparser.o genedisplay.o estwise3.o estslim3.o estloop3.o estfrag3.o estslimloop.o gwquickdb.o threestatedb.o pfamhmmer1db.o pwmdna.o wise2xhmmer2.o genewisemodeldb.o seqhit.o standardout.o geneparser4.o sw_wrap.o abc.o pba.o seqaligndisplay.o dbadisplay.o proteinsw.o estquick3.o ar: `u' modifier ignored since `D' is the default (see `U') ar: creating libmodel.a make[3]: Leaving directory '/<>/src/models' /usr/bin/make bin make[3]: Entering directory '/<>/src' mkdir bin cp models/pswdb models/psw models/genewisedb models/estwisedb models/estwise models/genewise models/dba models/dnal models/promoterwise network/scanwise_server models/scanwise ./bin ./welcome.csh Welcome to Wise2.4 The executable programs are in the ./bin directory You must set your WISECONFIGDIR to the config directory before using the programs ie, type setenv WISECONFIGDIR /<>/src/../wisecfg/ to try an example, try cd example and then ../bin/genewise road.pep human.genomic to build perl, type make perl and follow the instructions to test the package, type make test make[3]: Leaving directory '/<>/src' make[2]: Leaving directory '/<>/src' /usr/bin/make -C debian/manpages.d make[2]: Entering directory '/<>/debian/manpages.d' docbook-to-man dba.sgml > dba.1 docbook-to-man dnal.sgml > dnal.1 docbook-to-man estwise.sgml > estwise.1 docbook-to-man estwisedb.sgml > estwisedb.1 docbook-to-man genewise.sgml > genewise.1 docbook-to-man genewisedb.sgml > genewisedb.1 docbook-to-man genomewise.sgml > genomewise.1 docbook-to-man promoterwise.sgml > promoterwise.1 docbook-to-man psw.sgml > psw.1 docbook-to-man pswdb.sgml > pswdb.1 docbook-to-man scanwise.sgml > scanwise.1 docbook-to-man scanwise_server.sgml > scanwise_server.1 make[2]: Leaving directory '/<>/debian/manpages.d' find src/models/ src/dynlibsrc/ -name '*.tex' -print0 | LC_ALL=C sort -z | xargs -0 cat | perl docs/gettex.pl > docs/temp.tex cat docs/wise2api.tex docs/temp.tex docs/apiend.tex > docs/api.tex sed -i 's/ sw_wrap / sw\\_wrap /' docs/api.tex sed -i 's/label{module_sequence\\_codon}/label{module_sequence_codon}/' docs/api.tex sed -i 's/Wise2::GeneParameter21_wrap/Wise2::GeneParameter21\\_wrap/' docs/api.tex cd docs && pdflatex api.tex This is pdfTeX, Version 3.14159265-2.6-1.40.18 (TeX Live 2017/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./api.tex LaTeX2e <2017-04-15> Babel <3.12> and hyphenation patterns for 3 language(s) loaded. (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2014/09/29 v1.4h Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) No file api.aux. (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] No file api.toc. [2] [3] Overfull \hbox (1.49698pt too wide) in paragraph at lines 109--109 [] \OT1/cmtt/m/n/10 print "You must give a file to revcom for a reverse to w ork!";[] [4] [5] (/usr/share/texlive/texmf-dist/tex/latex/base/omscmr.fd) LaTeX Warning: Reference `object_CodonTable' on page 6 undefined on input line 198. LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 19 9. LaTeX Warning: Reference `object_CompMat' on page 6 undefined on input line 205 . LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 20 6. LaTeX Warning: Reference `object_Protein' on page 6 undefined on input line 207 . LaTeX Warning: Reference `object_CompMat' on page 6 undefined on input line 208 . LaTeX Warning: Reference `module_sw_wrap' on page 6 undefined on input line 209 . LaTeX Warning: Reference `module_seqaligndisplay' on page 6 undefined on input line 210. LaTeX Warning: Reference `object_Protein' on page 6 undefined on input line 215 . LaTeX Warning: Reference `object_Sequence' on page 6 undefined on input line 21 5. [6] LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 16. LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 17. LaTeX Warning: Reference `module_sw_wrap' on page 7 undefined on input line 218 . LaTeX Warning: Reference `object_Hscore' on page 7 undefined on input line 219. LaTeX Warning: Reference `object_DataEntry' on page 7 undefined on input line 2 21. LaTeX Warning: Reference `object_ProteinDB' on page 7 undefined on input line 2 21. LaTeX Warning: Reference `object_Sequence' on page 7 undefined on input line 22 8. LaTeX Warning: Reference `object_Protein' on page 7 undefined on input line 229 . LaTeX Warning: Reference `object_Sequence' on page 7 undefined on input line 23 0. LaTeX Warning: Reference `object_Genomic' on page 7 undefined on input line 231 . LaTeX Warning: Reference `object_GeneFrequency' on page 7 undefined on input li ne 233. LaTeX Warning: Reference `object_CodonTable' on page 7 undefined on input line 234. LaTeX Warning: Reference `object_RandomModelDNA' on page 7 undefined on input l ine 235. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 236. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 237. Overfull \hbox (21.30891pt too wide) in paragraph at lines 237--238 []\OT1/cmr/m/n/10 Build an en-tire pa-ram-e-ter set for ge-newise us-ing Wise2: :GeneParameter21[]wrap LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 238. LaTeX Warning: Reference `module_gwrap' on page 7 undefined on input line 239. [7] [8] [9] LaTeX Warning: Reference `module_gwrap' on page 10 undefined on input line 389. [10] LaTeX Warning: Reference `module_estwrap' on page 11 undefined on input line 39 1. LaTeX Warning: Reference `module_sw_wrap' on page 11 undefined on input line 39 3. LaTeX Warning: Reference `module_genedisplay' on page 11 undefined on input lin e 395. LaTeX Warning: Reference `module_seqaligndisplay' on page 11 undefined on input line 397. LaTeX Warning: Reference `module_threestatemodel' on page 11 undefined on input line 399. LaTeX Warning: Reference `module_threestatedb' on page 11 undefined on input li ne 400. LaTeX Warning: Reference `module_genefrequency' on page 11 undefined on input l ine 401. LaTeX Warning: Reference `module_geneparameter' on page 11 undefined on input l ine 402. LaTeX Warning: Reference `module_cdparser' on page 11 undefined on input line 4 03. LaTeX Warning: Reference `module_sequence' on page 11 undefined on input line 4 10. LaTeX Warning: Reference `module_sequencedb' on page 11 undefined on input line 411. LaTeX Warning: Reference `module_protein' on page 11 undefined on input line 41 2. LaTeX Warning: Reference `module_proteindb' on page 11 undefined on input line 413. LaTeX Warning: Reference `module_genomic' on page 11 undefined on input line 41 4. LaTeX Warning: Reference `module_genomicdb' on page 11 undefined on input line 415. LaTeX Warning: Reference `module_cdna' on page 11 undefined on input line 416. LaTeX Warning: Reference `module_cdnadb' on page 11 undefined on input line 417 . LaTeX Warning: Reference `module_probability' on page 11 undefined on input lin e 423. LaTeX Warning: Reference `module_codon' on page 11 undefined on input line 424. LaTeX Warning: Reference `module_compmat' on page 11 undefined on input line 42 5. LaTeX Warning: Reference `module_codonmat' on page 11 undefined on input line 4 26. LaTeX Warning: Reference `module_codonmapper' on page 11 undefined on input lin e 427. [11] LaTeX Warning: Reference `module_hscore' on page 12 undefined on input line 433 . LaTeX Warning: Reference `module_histogram' on page 12 undefined on input line 434. LaTeX Warning: Reference `module_dbimpl' on page 12 undefined on input line 435 . LaTeX Warning: Reference `module_aln' on page 12 undefined on input line 441. LaTeX Warning: Reference `module_packaln' on page 12 undefined on input line 44 2. LaTeX Warning: Reference `module_basematrix' on page 12 undefined on input line 443. LaTeX Warning: Reference `object_AlnBlock' on page 12 undefined on input line 4 51. LaTeX Warning: Reference `object_AlnColumn' on page 12 undefined on input line 453. LaTeX Warning: Reference `object_AlnUnit' on page 12 undefined on input line 45 5. LaTeX Warning: Reference `object_AlnSequence' on page 12 undefined on input lin e 457. LaTeX Warning: Reference `accessing_fields' on page 12 undefined on input line 464. Overfull \hbox (6.8248pt too wide) in paragraph at lines 475--482 \OT1/cmr/m/n/10 AlnBlock is the main rep-re-sen-ta-tion of align-ments from Dy- na-mite. Each AlnBlock [12] LaTeX Warning: Reference `accessing_fields' on page 13 undefined on input line 513. [13] LaTeX Warning: Reference `accessing_fields' on page 14 undefined on input line 555. [14] LaTeX Warning: Reference `accessing_fields' on page 15 undefined on input line 623. [15] LaTeX Warning: Reference `object_AlnRange' on page 16 undefined on input line 6 52. LaTeX Warning: Reference `object_AlnRangeSet' on page 16 undefined on input lin e 654. LaTeX Warning: Reference `accessing_fields' on page 16 undefined on input line 661. LaTeX Warning: Reference `accessing_fields' on page 16 undefined on input line 688. [16] LaTeX Warning: Reference `object_cDNA' on page 17 undefined on input line 741. LaTeX Warning: Reference `accessing_fields' on page 17 undefined on input line 748. [17] [18] [19] LaTeX Warning: Reference `object_cDNADB' on page 20 undefined on input line 884 . LaTeX Warning: Reference `accessing_fields' on page 20 undefined on input line 924. [20] LaTeX Warning: Reference `object_CodonTable' on page 21 undefined on input line 1005. [21] [22] [23] [24] LaTeX Warning: Reference `accessing_fields' on page 25 undefined on input line 1213. [25] [26] [27] LaTeX Warning: Reference `object_CodonMapper' on page 28 undefined on input lin e 1363. LaTeX Warning: Reference `accessing_fields' on page 28 undefined on input line 1391. [28] Overfull \hbox (12.33003pt too wide) in paragraph at lines 1418--1419 []\OT1/cmtt/m/n/10 &Wise2::CodonMapper::sprinkle[]errors[]over[]CodonMapper (cm ,error) LaTeX Warning: Reference `object_ComplexSequence' on page 29 undefined on input line 1442. LaTeX Warning: Reference `object_ComplexSequenceEvalSet' on page 29 undefined o n input line 1444. LaTeX Warning: Reference `accessing_fields' on page 29 undefined on input line 1451. [29] LaTeX Warning: Reference `accessing_fields' on page 30 undefined on input line 1482. LaTeX Warning: Reference `object_CompMat' on page 30 undefined on input line 15 17. LaTeX Warning: Reference `accessing_fields' on page 30 undefined on input line 1524. [30] [31] LaTeX Warning: Reference `object_DBSearchImpl' on page 32 undefined on input li ne 1624. [32] LaTeX Warning: Reference `accessing_fields' on page 33 undefined on input line 1671. [33] LaTeX Warning: Reference `object_DnaMatrix' on page 34 undefined on input line 1736. LaTeX Warning: Reference `object_DnaProbMatrix' on page 34 undefined on input l ine 1738. [34] LaTeX Warning: Reference `accessing_fields' on page 35 undefined on input line 1799. LaTeX Warning: Reference `accessing_fields' on page 35 undefined on input line 1812. [35] LaTeX Warning: Reference `object_Gene' on page 36 undefined on input line 1844. LaTeX Warning: Reference `accessing_fields' on page 36 undefined on input line 1851. [36] [37] LaTeX Warning: Reference `object_Genomic' on page 38 undefined on input line 19 48. LaTeX Warning: Reference `object_GenomicRepeat' on page 38 undefined on input l ine 1950. [38] Overfull \hbox (0.5938pt too wide) in paragraph at lines 1989--1990 []\OT1/cmtt/m/n/10 Wise2[]Genomic[]from[]Sequence[]Nheuristic (seq,length[]of[] N) LaTeX Warning: Reference `accessing_fields' on page 39 undefined on input line 2038. [39] [40] LaTeX Warning: Reference `accessing_fields' on page 41 undefined on input line 2150. [41] LaTeX Warning: Reference `object_GenomicDB' on page 42 undefined on input line 2168. Overfull \hbox (65.9032pt too wide) in paragraph at lines 2175--2176 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB[]from[]single[]seq (gen,cses,score[]in []repeat[]coding) Overfull \hbox (43.1997pt too wide) in paragraph at lines 2176--2177 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB[]from[]single[]seq (gen,cses,score[]i n[]repeat[]coding) Overfull \hbox (41.12343pt too wide) in paragraph at lines 2192--2193 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[] cds[]score) Overfull \hbox (18.41994pt too wide) in paragraph at lines 2193--2194 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[ ]cds[]score) [42] LaTeX Warning: Reference `accessing_fields' on page 43 undefined on input line 2213. [43] LaTeX Warning: Reference `object_GenomicRegion' on page 44 undefined on input l ine 2298. LaTeX Warning: Reference `accessing_fields' on page 44 undefined on input line 2305. [44] Overfull \hbox (1.83012pt too wide) in paragraph at lines 2348--2349 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::read[]EMBL[]GenomicRegion[]file (file name) [45] Overfull \hbox (7.08008pt too wide) in paragraph at lines 2401--2402 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]ace[]GenomicRegion (gr,seq[]nam e,ofp) Overfull \hbox (3.5338pt too wide) in paragraph at lines 2426--2427 []\OT1/cmtt/m/n/10 Wise2[]show[]pretty[]GenomicRegion (gr,show[]supporting,ofp) Overfull \hbox (59.57962pt too wide) in paragraph at lines 2427--2428 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]pretty[]GenomicRegion (gr,show[ ]supporting,ofp) [46] [47] LaTeX Warning: Reference `object_Histogram' on page 48 undefined on input line 2505. [48] LaTeX Warning: Reference `accessing_fields' on page 49 undefined on input line 2553. Overfull \hbox (32.9967pt too wide) in paragraph at lines 2592--2592 [] \OT1/cmtt/m/n/10 b) cooperation with future versions of histogram.c would be possible.[] [49] [50] [51] Overfull \hbox (123.4428pt too wide) in paragraph at lines 2794--2795 []\OT1/cmtt/m/n/10 Wise2[]ExtremeValueSetHistogram (h,mu,lambda,lowbound,highbo und,wonka,ndegrees) Overfull \hbox (67.76958pt too wide) in paragraph at lines 2795--2796 []\OT1/cmtt/m/n/10 &Wise2::Histogram::set[]EVD (h,mu,lambda,lowbound,highbound, wonka,ndegrees) Overfull \hbox (33.66585pt too wide) in paragraph at lines 2797--2798 []\OT1/cmtt/m/n/10 $obj->set[]EVD(mu,lambda,lowbound,highbound,wonka,ndegrees) [52] [53] [54] LaTeX Warning: Reference `object_Hscore' on page 55 undefined on input line 293 0. LaTeX Warning: Reference `object_DataScore' on page 55 undefined on input line 2932. LaTeX Warning: Reference `object_DataEntry' on page 55 undefined on input line 2934. LaTeX Warning: Reference `accessing_fields' on page 55 undefined on input line 2961. Overfull \hbox (30.97293pt too wide) in paragraph at lines 2971--2972 []\OT1/cmr/m/n/10 should[]store Type [boolean (*should[]store)(int given[]score ,double in-ter-nal[]score[]level) [55] [56] [57] LaTeX Warning: Reference `accessing_fields' on page 58 undefined on input line 3162. [58] LaTeX Warning: Reference `accessing_fields' on page 59 undefined on input line 3188. LaTeX Warning: Reference `object_PackAln' on page 59 undefined on input line 32 29. [59] LaTeX Warning: Reference `object_PackAlnUnit' on page 60 undefined on input lin e 3231. LaTeX Warning: Reference `accessing_fields' on page 60 undefined on input line 3238. [60] LaTeX Warning: Reference `accessing_fields' on page 61 undefined on input line 3308. [61] [62] LaTeX Warning: Reference `object_Protein' on page 63 undefined on input line 34 31. LaTeX Warning: Reference `accessing_fields' on page 63 undefined on input line 3438. [63] LaTeX Warning: Reference `object_ProteinDB' on page 64 undefined on input line 3488. LaTeX Warning: Reference `accessing_fields' on page 64 undefined on input line 3545. [64] LaTeX Warning: Reference `object_RandomProteinDB' on page 65 undefined on input line 3590. LaTeX Warning: Reference `object_RandomDNADB' on page 65 undefined on input lin e 3592. LaTeX Warning: Reference `accessing_fields' on page 65 undefined on input line 3599. LaTeX Warning: Reference `accessing_fields' on page 65 undefined on input line 3620. [65] LaTeX Warning: Reference `object_RandomModelDNA' on page 66 undefined on input line 3642. LaTeX Warning: Reference `object_RandomModel' on page 66 undefined on input lin e 3644. LaTeX Warning: Reference `accessing_fields' on page 66 undefined on input line 3682. [66] LaTeX Warning: Reference `accessing_fields' on page 67 undefined on input line 3697. LaTeX Warning: Reference `object_Sequence' on page 67 undefined on input line 3 713. LaTeX Warning: Reference `object_SequenceSet' on page 67 undefined on input lin e 3715. [67] LaTeX Warning: Reference `accessing_fields' on page 68 undefined on input line 3779. [68] Overfull \hbox (16.34366pt too wide) in paragraph at lines 3839--3840 []\OT1/cmtt/m/n/10 Wise2[]force[]to[]dna[]Sequence (seq,fraction,number[]of[]co nver) [69] [70] [71] [72] [73] [74] LaTeX Warning: Reference `accessing_fields' on page 75 undefined on input line 4176. [75] [76] LaTeX Warning: Reference `object_SequenceDB' on page 77 undefined on input line 4265. LaTeX Warning: Reference `object_FileSource' on page 77 undefined on input line 4267. LaTeX Warning: Reference `accessing_fields' on page 77 undefined on input line 4294. [77] LaTeX Warning: Reference `accessing_fields' on page 78 undefined on input line 4355. LaTeX Warning: Reference `object_Exon' on page 78 undefined on input line 4381. LaTeX Warning: Reference `object_Transcript' on page 78 undefined on input line 4383. [78] LaTeX Warning: Reference `accessing_fields' on page 79 undefined on input line 4390. LaTeX Warning: Reference `accessing_fields' on page 79 undefined on input line 4413. [79] LaTeX Warning: Reference `object_Translation' on page 80 undefined on input lin e 4482. LaTeX Warning: Reference `accessing_fields' on page 80 undefined on input line 4489. Overfull \hbox (24.01358pt too wide) in paragraph at lines 4508--4515 \OT1/cmr/m/n/10 have any se-quence in it. When se-quence is asked for by get[]P rotein[]from[]Translation() [80] LaTeX Warning: Reference `object_cDNAParser' on page 81 undefined on input line 4549. [81] LaTeX Warning: Reference `accessing_fields' on page 82 undefined on input line 4579. LaTeX Warning: Reference `object_DnaStartEnd' on page 82 undefined on input lin e 4602. Overfull \hbox (62.7533pt too wide) in paragraph at lines 4609--4610 []\OT1/cmtt/m/n/10 Wise2[]make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap, text,dpri) Overfull \hbox (40.0498pt too wide) in paragraph at lines 4610--4611 []\OT1/cmtt/m/n/10 &Wise2::make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap ,text,dpri) [82] LaTeX Warning: Reference `accessing_fields' on page 83 undefined on input line 4655. Overfull \hbox (335.96082pt too wide) in paragraph at lines 4671--4672 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]sy n,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) Overfull \hbox (313.25732pt too wide) in paragraph at lines 4672--4673 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]s yn,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) [83] Overfull \hbox (329.87091pt too wide) in paragraph at lines 4698--4699 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp,c m,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri,palpoi) Overfull \hbox (270.41774pt too wide) in paragraph at lines 4699--4700 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp, cm,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri) [84] Overfull \hbox (265.40146pt too wide) in paragraph at lines 4732--4733 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,ct ,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri,palpoi) Overfull \hbox (205.94829pt too wide) in paragraph at lines 4733--4734 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,c t,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri) [85] Overfull \hbox (47.00343pt too wide) in paragraph at lines 4780--4781 []\OT1/cmtt/m/n/10 Wise2[]protein2genomic[]ascii[]display (alb,p,gen,ct,name,ma in,ofp) Overfull \hbox (24.29994pt too wide) in paragraph at lines 4781--4782 []\OT1/cmtt/m/n/10 &Wise2::protein2genomic[]ascii[]display (alb,p,gen,ct,name,m ain,ofp) [86] Overfull \hbox (188.7522pt too wide) in paragraph at lines 4801--4802 []\OT1/cmtt/m/n/10 Wise2[]protcdna[]ascii[]display (alb,protsequence,protname,p rotoff,cdna,ct,name,main,mult,ofp) Overfull \hbox (166.0487pt too wide) in paragraph at lines 4802--4803 []\OT1/cmtt/m/n/10 &Wise2::protcdna[]ascii[]display (alb,protsequence,protname, protoff,cdna,ct,name,main,mult,ofp) LaTeX Warning: Reference `object_GeneFrequency21' on page 87 undefined on input line 4830. LaTeX Warning: Reference `object_GeneConsensus' on page 87 undefined on input l ine 4832. LaTeX Warning: Reference `object_GeneSingleCons' on page 87 undefined on input line 4834. [87] LaTeX Warning: Reference `accessing_fields' on page 88 undefined on input line 4879. Overfull \hbox (1.40793pt too wide) in paragraph at lines 4893--4894 []\OT1/cmr/m/n/10 transition[GENEFREQUENCY21[]TRANSITION[]LEN] Type [dou-ble : Scalar] LaTeX Warning: Reference `accessing_fields' on page 88 undefined on input line 4906. [88] LaTeX Warning: Reference `accessing_fields' on page 89 undefined on input line 4921. LaTeX Warning: Reference `object_GeneParameter21' on page 89 undefined on input line 4937. LaTeX Warning: Reference `accessing_fields' on page 89 undefined on input line 4944. [89] LaTeX Warning: Reference `object_MatchSummarySet' on page 90 undefined on input line 4990. LaTeX Warning: Reference `object_MatchSummary' on page 90 undefined on input li ne 4992. LaTeX Warning: Reference `accessing_fields' on page 90 undefined on input line 4999. Overfull \hbox (71.7832pt too wide) in paragraph at lines 5014--5015 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]estwise (alb,qname,o ffset,target) Overfull \hbox (1.83012pt too wide) in paragraph at lines 5015--5016 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]es twise Overfull \hbox (62.22557pt too wide) in paragraph at lines 5017--5018 []\OT1/cmtt/m/n/10 $obj->MatchSummarySet[]from[]AlnBlock[]estwise(qname,offset, target) [90] Overfull \hbox (82.28311pt too wide) in paragraph at lines 5040--5041 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]genewise (alb,qname, protoff,target) Overfull \hbox (7.08008pt too wide) in paragraph at lines 5041--5042 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]ge newise Overfull \hbox (72.72548pt too wide) in paragraph at lines 5043--5044 []\OT1/cmtt/m/n/10 $obj->MatchSummarySet[]from[]AlnBlock[]genewise(qname,protof f,target) LaTeX Warning: Reference `accessing_fields' on page 91 undefined on input line 5065. [91] LaTeX Warning: Reference `object_PfamHmmer1DB' on page 92 undefined on input li ne 5107. LaTeX Warning: Reference `object_PfamHmmer1Entry' on page 92 undefined on input line 5109. LaTeX Warning: Reference `accessing_fields' on page 92 undefined on input line 5116. LaTeX Warning: Reference `accessing_fields' on page 92 undefined on input line 5152. [92] Overfull \hbox (92.78302pt too wide) in paragraph at lines 5174--5175 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]str[]align (alb,qname,query,tname,targ et,name,main,ofp) Overfull \hbox (70.07953pt too wide) in paragraph at lines 5175--5176 []\OT1/cmtt/m/n/10 &Wise2::write[]pretty[]str[]align (alb,qname,query,tname,tar get,name,main,ofp) [93] Overfull \hbox (3.5338pt too wide) in paragraph at lines 5217--5218 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]Protein[]align (alb,q,t,name,main,ofp) LaTeX Warning: Reference `object_DnaSequenceHitList' on page 94 undefined on in put line 5243. LaTeX Warning: Reference `object_SegmentHitList' on page 94 undefined on input line 5245. LaTeX Warning: Reference `object_SegmentHit' on page 94 undefined on input line 5247. [94] LaTeX Warning: Reference `accessing_fields' on page 95 undefined on input line 5254. Overfull \hbox (29.5499pt too wide) in paragraph at lines 5290--5291 []\OT1/cmtt/m/n/10 &Wise2::DnaSequenceHitList::read[]MSPcrunch[]DnaSequenceHitL ist (ifp) [95] LaTeX Warning: Reference `accessing_fields' on page 96 undefined on input line 5307. LaTeX Warning: Reference `accessing_fields' on page 96 undefined on input line 5320. Overfull \hbox (99.50298pt too wide) in paragraph at lines 5348--5349 []\OT1/cmtt/m/n/10 Wise2[]Align[]strings[]ProteinSmithWaterman (one,two,comp,ga p,ext,dpenv,dpri) Overfull \hbox (76.79948pt too wide) in paragraph at lines 5349--5350 []\OT1/cmtt/m/n/10 &Wise2::Align[]strings[]ProteinSmithWaterman (one,two,comp,g ap,ext,dpenv,dpri) [96] Overfull \hbox (110.00288pt too wide) in paragraph at lines 5373--5374 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinSmithWaterman (one,two,comp, gap,ext,dpenv,dpri) Overfull \hbox (87.2994pt too wide) in paragraph at lines 5374--5375 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinSmithWaterman (one,two,comp ,gap,ext,dpenv,dpri) Overfull \hbox (7.58401pt too wide) in paragraph at lines 5386--5387 []\OT1/cmr/m/n/10 [OWNER] new AlnBlock struc-ture rep-re-sent-ing the align-men t [AlnBlock [97] Overfull \hbox (68.00325pt too wide) in paragraph at lines 5407--5408 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext, dpenv,dpri) Overfull \hbox (45.29976pt too wide) in paragraph at lines 5408--5409 []\OT1/cmtt/m/n/10 &Wise2::Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext ,dpenv,dpri) Overfull \hbox (5.0038pt too wide) in paragraph at lines 5434--5435 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]ABC (one,two,comp,a,b,c,dpenv,dpri) [98] Overfull \hbox (47.00343pt too wide) in paragraph at lines 5455--5456 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpen v,dpri) Overfull \hbox (24.29994pt too wide) in paragraph at lines 5456--5457 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpe nv,dpri) Overfull \hbox (86.01088pt too wide) in paragraph at lines 5471--5474 \OT1/cmr/m/n/10 Align[]Sequences[]ProteinABC this func-tion is anal-o-gous to A lign[]Sequences[]ProteinSmithWaterman Overfull \hbox (240.62169pt too wide) in paragraph at lines 5478--5479 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,ex t,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (217.9182pt too wide) in paragraph at lines 5479--5480 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,e xt,bits[]cutoff,report[]level,die[]on[]error,dbsi) [99] Overfull \hbox (235.37173pt too wide) in paragraph at lines 5500--5501 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b,c ,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (212.66824pt too wide) in paragraph at lines 5501--5502 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b, c,bits[]cutoff,report[]level,die[]on[]error,dbsi) [100] Overfull \hbox (359.90063pt too wide) in paragraph at lines 5523--5524 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentry ,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) Overfull \hbox (337.19714pt too wide) in paragraph at lines 5524--5525 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentr y,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) LaTeX Warning: Reference `object_ThreeStateDB' on page 101 undefined on input l ine 5552. LaTeX Warning: Reference `accessing_fields' on page 101 undefined on input line 5559. [101] Overfull \hbox (15.42177pt too wide) in paragraph at lines 5587--5588 []\OT1/cmr/m/n/10 reload[]generic Type [Three-State-Model * (*reload[]generic)( ThreeStateDB * tdb,int Overfull \hbox (3.42192pt too wide) in paragraph at lines 5594--5595 []\OT1/cmr/m/n/10 dataentry[]add Type [boolean (*dataen-try[]add)(ThreeStateDB * tdb,DataEntry Overfull \hbox (41.78299pt too wide) in paragraph at lines 5598--5599 []\OT1/cmr/m/n/10 index[]generic Type [Three-State-Model * (*in-dex[]generic)(T hreeStateDB *tdb,DataEntry [102] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5669--5670 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateDB::new[]proteindb[]ThreeStateDB (sdb,comp ,gap,ext) [103] [104] LaTeX Warning: Reference `object_ThreeStateModel' on page 105 undefined on inpu t line 5732. LaTeX Warning: Reference `object_ThreeStateUnit' on page 105 undefined on input line 5734. LaTeX Warning: Reference `accessing_fields' on page 105 undefined on input line 5775. [105] Overfull \hbox (16.10999pt too wide) in paragraph at lines 5802--5803 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]global[]model (tsm,prob[]int o[]model) Overfull \hbox (102.65288pt too wide) in paragraph at lines 5822--5823 []\OT1/cmtt/m/n/10 Wise2[]force[]weighted[]local[]model (tsm,prob[]into[]model, ratio[]start,ratio[]end) Overfull \hbox (169.19861pt too wide) in paragraph at lines 5823--5824 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]weighted[]local[]model (tsm, prob[]into[]model,ratio[]start,ratio[]end) Overfull \hbox (93.09525pt too wide) in paragraph at lines 5825--5826 []\OT1/cmtt/m/n/10 $obj->force[]weighted[]local[]model(prob[]into[]model,ratio[ ]start,ratio[]end) Overfull \hbox (49.31339pt too wide) in paragraph at lines 5845--5846 []\OT1/cmtt/m/n/10 Wise2[]ThreeStateModel[]from[]half[]bit[]Sequence (pro,mat,r m,gap,ext) [106] Overfull \hbox (5.61008pt too wide) in paragraph at lines 5846--5847 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::ThreeStateModel[]from[]half[]bit[]S equence Overfull \hbox (39.75575pt too wide) in paragraph at lines 5848--5849 []\OT1/cmtt/m/n/10 $obj->ThreeStateModel[]from[]half[]bit[]Sequence(mat,rm,gap, ext) Overfull \hbox (51.38966pt too wide) in paragraph at lines 5872--5873 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::write[]HMMer[]1[]7[]ascii[]ThreeSta teModel (tsm,ofp) LaTeX Warning: Reference `accessing_fields' on page 107 undefined on input line 5890. [107] [108] (./api.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on api.pdf (108 pages, 303656 bytes). Transcript written on api.log. cd docs && pdflatex api.tex This is pdfTeX, Version 3.14159265-2.6-1.40.18 (TeX Live 2017/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./api.tex LaTeX2e <2017-04-15> Babel <3.12> and hyphenation patterns for 3 language(s) loaded. (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2014/09/29 v1.4h Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (./api.aux) (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] (./api.toc [2] [3] [4] [5] [6] [7] [8] [9]) [10] [11] Overfull \hbox (1.49698pt too wide) in paragraph at lines 109--109 [] \OT1/cmtt/m/n/10 print "You must give a file to revcom for a reverse to w ork!";[] [12] [13] (/usr/share/texlive/texmf-dist/tex/latex/base/omscmr.fd) [14] LaTeX Warning: Reference `object_GeneFrequency' on page 15 undefined on input l ine 233. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 236. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 237. Overfull \hbox (21.30891pt too wide) in paragraph at lines 237--238 []\OT1/cmr/m/n/10 Build an en-tire pa-ram-e-ter set for ge-newise us-ing Wise2: :GeneParameter21[]wrap LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 238. LaTeX Warning: Reference `module_gwrap' on page 15 undefined on input line 239. [15] [16] [17] LaTeX Warning: Reference `module_gwrap' on page 18 undefined on input line 389. [18] LaTeX Warning: Reference `module_codonmat' on page 19 undefined on input line 4 26. [19] LaTeX Warning: Reference `module_dbimpl' on page 20 undefined on input line 435 . Overfull \hbox (6.8248pt too wide) in paragraph at lines 475--482 \OT1/cmr/m/n/10 AlnBlock is the main rep-re-sen-ta-tion of align-ments from Dy- na-mite. Each AlnBlock [20] [21] [22] [23] [24] [25] [26] [27] [28] [29] [30] [31] [32] [33] [34] [35] [36] Overfull \hbox (12.33003pt too wide) in paragraph at lines 1418--1419 []\OT1/cmtt/m/n/10 &Wise2::CodonMapper::sprinkle[]errors[]over[]CodonMapper (cm ,error) [37] [38] [39] [40] [41] [42] [43] [44] [45] [46] Overfull \hbox (0.5938pt too wide) in paragraph at lines 1989--1990 []\OT1/cmtt/m/n/10 Wise2[]Genomic[]from[]Sequence[]Nheuristic (seq,length[]of[] N) [47] [48] [49] Overfull \hbox (65.9032pt too wide) in paragraph at lines 2175--2176 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB[]from[]single[]seq (gen,cses,score[]in []repeat[]coding) Overfull \hbox (43.1997pt too wide) in paragraph at lines 2176--2177 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB[]from[]single[]seq (gen,cses,score[]i n[]repeat[]coding) Overfull \hbox (41.12343pt too wide) in paragraph at lines 2192--2193 []\OT1/cmtt/m/n/10 Wise2[]new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[] cds[]score) Overfull \hbox (18.41994pt too wide) in paragraph at lines 2193--2194 []\OT1/cmtt/m/n/10 &Wise2::new[]GenomicDB (seqdb,cses,length[]of[]N,repeat[]in[ ]cds[]score) [50] [51] [52] Overfull \hbox (1.83012pt too wide) in paragraph at lines 2348--2349 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::read[]EMBL[]GenomicRegion[]file (file name) [53] Overfull \hbox (7.08008pt too wide) in paragraph at lines 2401--2402 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]ace[]GenomicRegion (gr,seq[]nam e,ofp) Overfull \hbox (3.5338pt too wide) in paragraph at lines 2426--2427 []\OT1/cmtt/m/n/10 Wise2[]show[]pretty[]GenomicRegion (gr,show[]supporting,ofp) Overfull \hbox (59.57962pt too wide) in paragraph at lines 2427--2428 []\OT1/cmtt/m/n/10 &Wise2::GenomicRegion::show[]pretty[]GenomicRegion (gr,show[ ]supporting,ofp) [54] [55] [56] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2592--2592 [] \OT1/cmtt/m/n/10 b) cooperation with future versions of histogram.c would be possible.[] [57] [58] [59] Overfull \hbox (123.4428pt too wide) in paragraph at lines 2794--2795 []\OT1/cmtt/m/n/10 Wise2[]ExtremeValueSetHistogram (h,mu,lambda,lowbound,highbo und,wonka,ndegrees) Overfull \hbox (67.76958pt too wide) in paragraph at lines 2795--2796 []\OT1/cmtt/m/n/10 &Wise2::Histogram::set[]EVD (h,mu,lambda,lowbound,highbound, wonka,ndegrees) Overfull \hbox (33.66585pt too wide) in paragraph at lines 2797--2798 []\OT1/cmtt/m/n/10 $obj->set[]EVD(mu,lambda,lowbound,highbound,wonka,ndegrees) [60] [61] [62] Overfull \hbox (30.97293pt too wide) in paragraph at lines 2971--2972 []\OT1/cmr/m/n/10 should[]store Type [boolean (*should[]store)(int given[]score ,double in-ter-nal[]score[]level) [63] [64] [65] [66] [67] [68] [69] [70] [71] [72] [73] [74] [75] [76] Overfull \hbox (16.34366pt too wide) in paragraph at lines 3839--3840 []\OT1/cmtt/m/n/10 Wise2[]force[]to[]dna[]Sequence (seq,fraction,number[]of[]co nver) [77] [78] [79] [80] [81] [82] [83] [84] [85] [86] [87] Overfull \hbox (24.01358pt too wide) in paragraph at lines 4508--4515 \OT1/cmr/m/n/10 have any se-quence in it. When se-quence is asked for by get[]P rotein[]from[]Translation() [88] [89] Overfull \hbox (62.7533pt too wide) in paragraph at lines 4609--4610 []\OT1/cmtt/m/n/10 Wise2[]make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap, text,dpri) Overfull \hbox (40.0498pt too wide) in paragraph at lines 4610--4611 []\OT1/cmtt/m/n/10 &Wise2::make[]align[]dnaalign (one,two,mat,se,qgap,qext,tgap ,text,dpri) [90] Overfull \hbox (335.96082pt too wide) in paragraph at lines 4671--4672 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]sy n,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) Overfull \hbox (313.25732pt too wide) in paragraph at lines 4672--4673 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]TSM[]estwise (tdb,cdb,cp,cm,rmd,use[]s yn,alg,bits[]cutoff,allN,flat[]insert,report[]level,die[]on[]error,dbsi) [91] Overfull \hbox (329.87091pt too wide) in paragraph at lines 4698--4699 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp,c m,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri,palpoi) Overfull \hbox (270.41774pt too wide) in paragraph at lines 4699--4700 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]Protein[]estwise[]wrap (pro,cdna,cp, cm,ct,comp,gap,ext,is[]global,rmd,alg,rm,use[]syn,allN,dpri) [92] Overfull \hbox (265.40146pt too wide) in paragraph at lines 4732--4733 []\OT1/cmtt/m/n/10 Wise2[]AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,ct ,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri,palpoi) Overfull \hbox (205.94829pt too wide) in paragraph at lines 4733--4734 []\OT1/cmtt/m/n/10 &Wise2::AlnBlock[]from[]TSM[]estwise[]wrap (tsm,cdna,cp,cm,c t,rmd,alg,use[]syn,force[]flat[]insert,allN,dpri) [93] Overfull \hbox (47.00343pt too wide) in paragraph at lines 4780--4781 []\OT1/cmtt/m/n/10 Wise2[]protein2genomic[]ascii[]display (alb,p,gen,ct,name,ma in,ofp) Overfull \hbox (24.29994pt too wide) in paragraph at lines 4781--4782 []\OT1/cmtt/m/n/10 &Wise2::protein2genomic[]ascii[]display (alb,p,gen,ct,name,m ain,ofp) [94] Overfull \hbox (188.7522pt too wide) in paragraph at lines 4801--4802 []\OT1/cmtt/m/n/10 Wise2[]protcdna[]ascii[]display (alb,protsequence,protname,p rotoff,cdna,ct,name,main,mult,ofp) Overfull \hbox (166.0487pt too wide) in paragraph at lines 4802--4803 []\OT1/cmtt/m/n/10 &Wise2::protcdna[]ascii[]display (alb,protsequence,protname, protoff,cdna,ct,name,main,mult,ofp) [95] Overfull \hbox (1.40793pt too wide) in paragraph at lines 4893--4894 []\OT1/cmr/m/n/10 transition[GENEFREQUENCY21[]TRANSITION[]LEN] Type [dou-ble : Scalar] [96] [97] Overfull \hbox (71.7832pt too wide) in paragraph at lines 5014--5015 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]estwise (alb,qname,o ffset,target) Overfull \hbox (1.83012pt too wide) in paragraph at lines 5015--5016 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]es twise Overfull \hbox (62.22557pt too wide) in paragraph at lines 5017--5018 []\OT1/cmtt/m/n/10 $obj->MatchSummarySet[]from[]AlnBlock[]estwise(qname,offset, target) [98] Overfull \hbox (82.28311pt too wide) in paragraph at lines 5040--5041 []\OT1/cmtt/m/n/10 Wise2[]MatchSummarySet[]from[]AlnBlock[]genewise (alb,qname, protoff,target) Overfull \hbox (7.08008pt too wide) in paragraph at lines 5041--5042 []\OT1/cmtt/m/n/10 &Wise2::MatchSummarySet::MatchSummarySet[]from[]AlnBlock[]ge newise Overfull \hbox (72.72548pt too wide) in paragraph at lines 5043--5044 []\OT1/cmtt/m/n/10 $obj->MatchSummarySet[]from[]AlnBlock[]genewise(qname,protof f,target) [99] [100] Overfull \hbox (92.78302pt too wide) in paragraph at lines 5174--5175 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]str[]align (alb,qname,query,tname,targ et,name,main,ofp) Overfull \hbox (70.07953pt too wide) in paragraph at lines 5175--5176 []\OT1/cmtt/m/n/10 &Wise2::write[]pretty[]str[]align (alb,qname,query,tname,tar get,name,main,ofp) [101] Overfull \hbox (3.5338pt too wide) in paragraph at lines 5217--5218 []\OT1/cmtt/m/n/10 Wise2[]write[]pretty[]Protein[]align (alb,q,t,name,main,ofp) [102] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5290--5291 []\OT1/cmtt/m/n/10 &Wise2::DnaSequenceHitList::read[]MSPcrunch[]DnaSequenceHitL ist (ifp) [103] Overfull \hbox (99.50298pt too wide) in paragraph at lines 5348--5349 []\OT1/cmtt/m/n/10 Wise2[]Align[]strings[]ProteinSmithWaterman (one,two,comp,ga p,ext,dpenv,dpri) Overfull \hbox (76.79948pt too wide) in paragraph at lines 5349--5350 []\OT1/cmtt/m/n/10 &Wise2::Align[]strings[]ProteinSmithWaterman (one,two,comp,g ap,ext,dpenv,dpri) [104] Overfull \hbox (110.00288pt too wide) in paragraph at lines 5373--5374 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinSmithWaterman (one,two,comp, gap,ext,dpenv,dpri) Overfull \hbox (87.2994pt too wide) in paragraph at lines 5374--5375 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinSmithWaterman (one,two,comp ,gap,ext,dpenv,dpri) Overfull \hbox (7.58401pt too wide) in paragraph at lines 5386--5387 []\OT1/cmr/m/n/10 [OWNER] new AlnBlock struc-ture rep-re-sent-ing the align-men t [AlnBlock [105] Overfull \hbox (68.00325pt too wide) in paragraph at lines 5407--5408 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext, dpenv,dpri) Overfull \hbox (45.29976pt too wide) in paragraph at lines 5408--5409 []\OT1/cmtt/m/n/10 &Wise2::Align[]Proteins[]SmithWaterman (one,two,comp,gap,ext ,dpenv,dpri) Overfull \hbox (5.0038pt too wide) in paragraph at lines 5434--5435 []\OT1/cmtt/m/n/10 Wise2[]Align[]Proteins[]ABC (one,two,comp,a,b,c,dpenv,dpri) [106] Overfull \hbox (47.00343pt too wide) in paragraph at lines 5455--5456 []\OT1/cmtt/m/n/10 Wise2[]Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpen v,dpri) Overfull \hbox (24.29994pt too wide) in paragraph at lines 5456--5457 []\OT1/cmtt/m/n/10 &Wise2::Align[]Sequences[]ProteinABC (one,two,comp,a,b,c,dpe nv,dpri) Overfull \hbox (86.01088pt too wide) in paragraph at lines 5471--5474 \OT1/cmr/m/n/10 Align[]Sequences[]ProteinABC this func-tion is anal-o-gous to A lign[]Sequences[]ProteinSmithWaterman Overfull \hbox (240.62169pt too wide) in paragraph at lines 5478--5479 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,ex t,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (217.9182pt too wide) in paragraph at lines 5479--5480 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinSW (querydb,targetdb,comp,gap,e xt,bits[]cutoff,report[]level,die[]on[]error,dbsi) [107] Overfull \hbox (235.37173pt too wide) in paragraph at lines 5500--5501 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b,c ,bits[]cutoff,report[]level,die[]on[]error,dbsi) Overfull \hbox (212.66824pt too wide) in paragraph at lines 5501--5502 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinABC (querydb,targetdb,comp,a,b, c,bits[]cutoff,report[]level,die[]on[]error,dbsi) [108] Overfull \hbox (359.90063pt too wide) in paragraph at lines 5523--5524 []\OT1/cmtt/m/n/10 Wise2[]Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentry ,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) Overfull \hbox (337.19714pt too wide) in paragraph at lines 5524--5525 []\OT1/cmtt/m/n/10 &Wise2::Hscore[]from[]ProteinBA (querydb,targetdb,comp,bentr y,bexit,bfor[]trans,b[]self[]trans,b3exit,bits[]cutoff,report[]level,dbsi) [109] Overfull \hbox (15.42177pt too wide) in paragraph at lines 5587--5588 []\OT1/cmr/m/n/10 reload[]generic Type [Three-State-Model * (*reload[]generic)( ThreeStateDB * tdb,int Overfull \hbox (3.42192pt too wide) in paragraph at lines 5594--5595 []\OT1/cmr/m/n/10 dataentry[]add Type [boolean (*dataen-try[]add)(ThreeStateDB * tdb,DataEntry Overfull \hbox (41.78299pt too wide) in paragraph at lines 5598--5599 []\OT1/cmr/m/n/10 index[]generic Type [Three-State-Model * (*in-dex[]generic)(T hreeStateDB *tdb,DataEntry [110] Overfull \hbox (29.5499pt too wide) in paragraph at lines 5669--5670 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateDB::new[]proteindb[]ThreeStateDB (sdb,comp ,gap,ext) [111] [112] [113] Overfull \hbox (16.10999pt too wide) in paragraph at lines 5802--5803 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]global[]model (tsm,prob[]int o[]model) Overfull \hbox (102.65288pt too wide) in paragraph at lines 5822--5823 []\OT1/cmtt/m/n/10 Wise2[]force[]weighted[]local[]model (tsm,prob[]into[]model, ratio[]start,ratio[]end) Overfull \hbox (169.19861pt too wide) in paragraph at lines 5823--5824 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::force[]weighted[]local[]model (tsm, prob[]into[]model,ratio[]start,ratio[]end) Overfull \hbox (93.09525pt too wide) in paragraph at lines 5825--5826 []\OT1/cmtt/m/n/10 $obj->force[]weighted[]local[]model(prob[]into[]model,ratio[ ]start,ratio[]end) Overfull \hbox (49.31339pt too wide) in paragraph at lines 5845--5846 []\OT1/cmtt/m/n/10 Wise2[]ThreeStateModel[]from[]half[]bit[]Sequence (pro,mat,r m,gap,ext) [114] Overfull \hbox (5.61008pt too wide) in paragraph at lines 5846--5847 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::ThreeStateModel[]from[]half[]bit[]S equence Overfull \hbox (39.75575pt too wide) in paragraph at lines 5848--5849 []\OT1/cmtt/m/n/10 $obj->ThreeStateModel[]from[]half[]bit[]Sequence(mat,rm,gap, ext) Overfull \hbox (51.38966pt too wide) in paragraph at lines 5872--5873 []\OT1/cmtt/m/n/10 &Wise2::ThreeStateModel::write[]HMMer[]1[]7[]ascii[]ThreeSta teModel (tsm,ofp) [115] [116] (./api.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on api.pdf (116 pages, 318176 bytes). Transcript written on api.log. cd docs && pdflatex dynamite.tex This is pdfTeX, Version 3.14159265-2.6-1.40.18 (TeX Live 2017/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./dynamite.tex LaTeX2e <2017-04-15> Babel <3.12> and hyphenation patterns for 3 language(s) loaded. (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2014/09/29 v1.4h Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) No file dynamite.aux. (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] No file dynamite.toc. [2] (/usr/share/texlive/texmf-dist/tex/latex/base/omscmr.fd) [3] LaTeX Warning: Reference `own_objects' on page 4 undefined on input line 77. [4] [5] [6] Overfull \hbox (4.11092pt too wide) in paragraph at lines 253--257 \OT1/cmr/m/n/10 tri-bu-tion from 'ftp://ftp.sanger.ac.uk/pub/birney/dynamite/dy n.x.tar.Z' (where [7] [8] [9] [10] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\npsw seq1 seq2\nBoth sequences in fasta format\n"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -g for gap value (an int) - rely on commandline error p rocessing[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -e for ext value (an int) - rely on commandline error p rocessing[] [11] Overfull \hbox (269.24464pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] [12] Overfull \hbox (22.4968pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * or WISEPERSONALDIR if it is not present in the current directory.[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] [13] Overfull \hbox (59.24648pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [14] Overfull \hbox (48.74657pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] [15] Overfull \hbox (80.24629pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 639--639 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext);[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 654--654 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] [16] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 EPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR DPTTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 EPE LRK+F+GGL+ TTD+ +R + Q+G +TD +VMR DP TKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMR DPNTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN RSESNVSTKR[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 GFVT++ EVDAAM RPH +DG+ V+PKRAV R+D R ++++ K+[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ RPGAHLTVKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 LYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKP RGFGFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 ++V G++ED E L +YF +YG + EI+ D+ + K RGF FVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKK RGFAFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 HDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRD RETRGGRSRD[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 HDSVD+ V+QK H VNGH C+VRK LSK EM+ A ++ GRS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN HDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS---- -SSQRGRSGS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GQRGGYNGGG-GGGGGWGGPAQRGGPGAYGGP-GGGGQG GYGGDYGG--[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GG GGG GG +G G G +GG GGGG G G G Y G[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYG GSGDGYNGFG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GWGQQGGGGQGGWGGPQQQQGGG-GWGQQGGGGQGGWGG PQQQQQGGWG[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GGGG G GG + GG G+G QG G GG G GG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN NDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG-YGGSGS YDSYNNGGGR[] [17] [18] Overfull \hbox (48.88945pt too wide) in paragraph at lines 793--795 []\OT1/cmr/m/n/10 The align-ment is the set of (i,j,) triples, where sta te is one of (Match,Insert,Delete) [19] [20] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [21] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [22] Overfull \hbox (32.64503pt too wide) in paragraph at lines 1015--1019 \OT1/cmr/m/n/10 and GE-NOMIC[]INTRON. No-tice how the source lines to and from GE-NOMIC[]INSERT Overfull \hbox (38.24666pt too wide) in paragraph at lines 1116--1116 []\OT1/cmtt/m/n/10 #define DnaMatrix_Score(dnamat,base1,base2) (dnamat->score[b ase1][base2])[] [23] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1116--1116 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_BASE(tar get,j))"[] [24] [25] Overfull \hbox (122.24593pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\nest2gen est-seq genomic-seq\nBoth sequences in fasta format\n"[] [26] Overfull \hbox (269.24464pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] [27] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] [28] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * cDNA2Gen has alot more parameter space than the paramet ers to this[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * program. Firstly we are treating errors similarly on ea ch side of the[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Secondly there is a rather complex interaction between the gap/extension[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * of what is thought to be sequencing error and the intro ns. Here we have[] Overfull \hbox (64.49643pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * one more parameter, and intron open penalty, which can be set, to prevent[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * One good way to parameterise all this would be to have a probabilistic[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * model of the processes, derive probabilities and then m ap them to ints[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * (probability.h has got these mappings, such as Probabil ity2Score).[] Overfull \hbox (101.24611pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [29] Overfull \hbox (74.99634pt too wide) in paragraph at lines 1342--1342 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0);[] [30] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 1 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GATGGT-TAT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT T T T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2132 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT--TAT-T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 49 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2178 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] [31] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 98 CAGTGGCAAGAAAAGGGGCTTTGCCT-TAGTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CAGTGGCAAGAAAAGGGGCTTTGCCT T GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2227 CAGTGGCAAGAAAAGGGGCTTTGCCTTT-GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 146 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2275 CTCCGTGGATAAGATTGTCA<-2295:2387->TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 182 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2404 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 231 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2453 ATGGCTAGTGCTTCATCCAGCCAAAGAG<-2481:2566 ->GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 267 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2575 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2624 ACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG<-2 660:2793->[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 352 GTNG-CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GT G CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2794 GT-GGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 400 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2842 ATGGCTATAATGGATTTGGCAATGATG<-2869:3805- >GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 436 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG--tttat gcA-CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG ++ + +A CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3815 TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATT-A- -CAACAATCA[] [32] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 482 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3861 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 531 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3910 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 580 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3959 AAG<-3962:4251->GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] [33] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [34] [35] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1600--1600 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_MyProteinSW(seqone,seqtwo,mat,-12, -2,NULL);[] Overfull \hbox (127.49588pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 fprintf(stdout,"%d,%d are matched with score %d\n",uni t->i+1,unit->j+1,unit->score);[] [36] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [37] [38] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [39] Overfull \hbox (258.74474pt too wide) in paragraph at lines 1849--1849 [] \OT1/cmtt/m/n/10 calc="ALPHA_SEQ_SCORE(query,i) + ALPHA_SEQ_SCORE(target,j) + mat_alpha.comp[SEQ_POS(query,i)][SEQ_POS(target,j)]"[] [40] [41] Overfull \hbox (20.54509pt too wide) in paragraph at lines 1911--1912 []\OT1/cmr/m/n/10 The macro Dna-Ma-trix[]Score which is de-fined at the top of the cdna2genomic.dy Overfull \hbox (17.24684pt too wide) in paragraph at lines 1928--1928 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_CODON(ta rget,j))"[] [42] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1944--1944 [] \OT1/cmtt/m/n/10 Mis-type in argument 3 of DNA\_MAT\_SCORE: wanted [b ase] got [codon][] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1955--1955 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,j),GENOMIC_BASE(tar get,j))"[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1967--1967 [] \OT1/cmtt/m/n/10 For function CDNA\_BASE, you have arguments j and qu ery, which do not[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1967--1967 []\OT1/cmtt/m/n/10 expect to paired directly in a function. This is just a warn ing that[] [43] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",one);[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",two);[] [44] [45] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"dbsearch [options] \n");[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** add more options here sometime, eg comp matrix and gap penalty*/[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** print out dbsearch options. We don't know here what im plementations are[] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 either possible or how they are specified. Of course, there is the problem[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 that we could clash our options with the dbsearchimpl options, but that[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 is not too likely, and this makes this program future proof wrt to new[] [46] Overfull \hbox (43.49661pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 * care about which implementation is used, and does not k now either (!)[] [47] Overfull \hbox (106.49606pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /* 10 means a score cutoff of 10, -1 means don't report on stderr search progress */[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (174.74547pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"Comparison to %s was %d score\n",out-> ds[i]->target->name,out->ds[i]->score);[] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [48] Overfull \hbox (69.74638pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s",te mp->baseseq->name);[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs, mat,-12,-2,NULL);[] Overfull \hbox (95.99615pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query->na me,temp->baseseq->name);[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 write_pretty_seq_align(alb,query,temp->baseseq,15,50,s tdout);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] [49] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2292--2292 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [50] [51] [52] [53] [54] Overfull \hbox (1.32472pt too wide) in paragraph at lines 2528--2534 \OT1/cmr/m/n/10 de-scribed by a "state...endstate" multi-line block. Within eac h "state...endstate" [55] [56] [57] [58] [59] Overfull \hbox (1.75064pt too wide) in paragraph at lines 2772--2776 \OT1/cmr/m/n/10 Dy-na-mite file: for ex-am-ple the fol-low-ing er-ror was made by mistyp-ing ``MATCH'' Overfull \hbox (59.24648pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 In matrix ProteinSW - State MATCH asks for source MA TCH2 but there is[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 Failing simple cross-checks, aborting before calc-li ne parsing[] [60] [61] [62] (./dynamite.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on dynamite.pdf (62 pages, 214083 bytes). Transcript written on dynamite.log. cd docs && pdflatex dynamite.tex This is pdfTeX, Version 3.14159265-2.6-1.40.18 (TeX Live 2017/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./dynamite.tex LaTeX2e <2017-04-15> Babel <3.12> and hyphenation patterns for 3 language(s) loaded. (/usr/share/texlive/texmf-dist/tex/latex/base/latex209.def Entering LaTeX 2.09 COMPATIBILITY MODE ************************************************************* !!WARNING!! !!WARNING!! !!WARNING!! !!WARNING!! This mode attempts to provide an emulation of the LaTeX 2.09 author environment so that OLD documents can be successfully processed. It should NOT be used for NEW documents! New documents should use Standard LaTeX conventions and start with the \documentclass command. Compatibility mode is UNLIKELY TO WORK with LaTeX 2.09 style files that change any internal macros, especially not with those that change the FONT SELECTION or OUTPUT ROUTINES. Therefore such style files MUST BE UPDATED to use Current Standard LaTeX: LaTeX2e. If you suspect that you may be using such a style file, which is probably very, very old by now, then you should attempt to get it updated by sending a copy of this error message to the author of that file. ************************************************************* (/usr/share/texlive/texmf-dist/tex/latex/base/tracefnt.sty) (/usr/share/texlive/texmf-dist/tex/latex/base/latexsym.sty)) (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2014/09/29 v1.4h Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (./dynamite.aux) (/usr/share/texlive/texmf-dist/tex/latex/base/ulasy.fd) [1{/var/lib/texmf/fonts /map/pdftex/updmap/pdftex.map}] (./dynamite.toc [2] Overfull \hbox (8.02837pt too wide) in paragraph at lines 50--50 [][] []\OT1/cmr/m/n/10 [Dynamite Level] Did not un-der-stand line [ source MAT CH]. ) [3] [4] (/usr/share/texlive/texmf-dist/tex/latex/base/omscmr.fd) [5] [6] [7] [8] Overfull \hbox (4.11092pt too wide) in paragraph at lines 253--257 \OT1/cmr/m/n/10 tri-bu-tion from 'ftp://ftp.sanger.ac.uk/pub/birney/dynamite/dy n.x.tar.Z' (where [9] [10] [11] [12] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\npsw seq1 seq2\nBoth sequences in fasta format\n"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -g for gap value (an int) - rely on commandline error p rocessing[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * -e for ext value (an int) - rely on commandline error p rocessing[] [13] Overfull \hbox (269.24464pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] [14] Overfull \hbox (22.4968pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * or WISEPERSONALDIR if it is not present in the current directory.[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] [15] Overfull \hbox (59.24648pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 588--588 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [16] Overfull \hbox (48.74657pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 * If the sequences are small enough then it should use ex plicit memory.[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext,NULL);[] [17] Overfull \hbox (80.24629pt too wide) in paragraph at lines 632--632 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 639--639 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs,comp ,-gap,-ext);[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 654--654 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] [18] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 EPENLRKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMR DPTTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 EPE LRK+F+GGL+ TTD+ +R + Q+G +TD +VMR DP TKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN EPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMR DPNTKRSRGF[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKN RSESNVSTKR[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 GFVT++ EVDAAM RPH +DG+ V+PKRAV R+D R ++++ K+[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ RPGAHLTVKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 LYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKP RGFGFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 ++V G++ED E L +YF +YG + EI+ D+ + K RGF FVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKK RGFAFVTFDD[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 HDSVDQCVLQKSHMVNGHRCDVRKGLSKDEMSKAQMNRD RETRGGRSRD[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 HDSVD+ V+QK H VNGH C+VRK LSK EM+ A ++ GRS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN HDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS---- -SSQRGRSGS[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GQRGGYNGGG-GGGGGWGGPAQRGGPGAYGGP-GGGGQG GYGGDYGG--[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GG GGG GG +G G G +GG GGGG G G G Y G[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN GNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYG GSGDGYNGFG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 Q22037 GWGQQGGGGQGGWGGPQQQQGGG-GWGQQGGGGQGGWGG PQQQQQGGWG[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 738--738 [] \OT1/cmtt/m/n/10 G GGGG G GG + GG G+G QG G GG G GG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 738--738 []\OT1/cmtt/m/n/10 ROA1_HUMAN NDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSG-YGGSGS YDSYNNGGGR[] [19] [20] Overfull \hbox (48.88945pt too wide) in paragraph at lines 793--795 []\OT1/cmr/m/n/10 The align-ment is the set of (i,j,) triples, where sta te is one of (Match,Insert,Delete) [21] [22] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [23] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 942--942 [] \OT1/cmtt/m/n/10 calc="AAMATCH(comp,AMINOACID(query,i),AMINOACID(ta rget,j))"[] [24] Overfull \hbox (32.64503pt too wide) in paragraph at lines 1015--1019 \OT1/cmr/m/n/10 and GE-NOMIC[]INTRON. No-tice how the source lines to and from GE-NOMIC[]INSERT Overfull \hbox (38.24666pt too wide) in paragraph at lines 1116--1116 []\OT1/cmtt/m/n/10 #define DnaMatrix_Score(dnamat,base1,base2) (dnamat->score[b ase1][base2])[] [25] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1116--1116 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_BASE(tar get,j))"[] [26] [27] Overfull \hbox (122.24593pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fprintf(ofp,"\nest2gen est-seq genomic-seq\nBoth sequences in fasta format\n"[] [28] Overfull \hbox (269.24464pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 if( strip_out_boolean_argument(&argc,argv,"h") == TRUE || strip_out_boolean_argument(&argc,argv,"-help") == TRUE) {[] [29] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 warn("Must have two arguments for sequence 1 and sequenc e 2 %d",argc);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] [30] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * cDNA2Gen has alot more parameter space than the paramet ers to this[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * program. Firstly we are treating errors similarly on ea ch side of the[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * Secondly there is a rather complex interaction between the gap/extension[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * of what is thought to be sequencing error and the intro ns. Here we have[] Overfull \hbox (64.49643pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * one more parameter, and intron open penalty, which can be set, to prevent[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * One good way to parameterise all this would be to have a probabilistic[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * model of the processes, derive probabilities and then m ap them to ints[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 * (probability.h has got these mappings, such as Probabil ity2Score).[] Overfull \hbox (101.24611pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0,NULL);[] Overfull \hbox (80.24629pt too wide) in paragraph at lines 1335--1335 [] \OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query ->name,target->name);[] [31] Overfull \hbox (74.99634pt too wide) in paragraph at lines 1342--1342 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_cDNA2Gen(query_cs,target_cs,dm,ga p,-ext,-gap,-ext,0);[] [32] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * To do this we need a cdna ComplexSequenceEvalSet and a genomic one[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * Really our genomic model should be alot more complex. T he 'default' one[] Overfull \hbox (38.24666pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * has 0 at GT----AG for 5' and 3' splice sites, and NEGI (= -infinity)[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * We could build up something much better, using complexc onsensi and[] Overfull \hbox (43.49661pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 * other machinery, but not for now . See the genewi se code if you[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1379--1379 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",target->name);[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 1 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GATGGT-TAT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT T T T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2132 GGTGGCATTAAAGAAGACACTGAAGAACATCACCTAAGA GAT--TAT-T[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 49 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2178 TTGAACAGTATGGAAAAATTGAAGTGATTGAAATCATGA CTGACCGAGG[] [33] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 98 CAGTGGCAAGAAAAGGGGCTTTGCCT-TAGTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CAGTGGCAAGAAAAGGGGCTTTGCCT T GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2227 CAGTGGCAAGAAAAGGGGCTTTGCCTTT-GTAACCTTTG ACGACCATGA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 146 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 CTCCGTGGATAAGATTGTCA TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2275 CTCCGTGGATAAGATTGTCA<-2295:2387->TTCAGA AATACCATAC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 182 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2404 TGTGAATGGCCACAACTGTGAAGTTAGAAAAGCCCTGTC AAAGCAAGAG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 231 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTAGTGCTTCATCCAGCCAAAGAG GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2453 ATGGCTAGTGCTTCATCCAGCCAAAGAG<-2481:2566 ->GTCGAAGT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 267 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2575 GGTTCTGGAAACTTTGGTGGTGGTCGTGGAGGTGGTTTC GGTGGGAATG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2624 ACAACTTCGGTCGTGGAGGAAACTTCAGTGGTCGTG<-2 660:2793->[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 352 GTNG-CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GT G CTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2794 GT-GGCTTTGGTGGCAGCCGTGGTGGTGGTGGATATGGT GGCAGTGGGG[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 400 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 ATGGCTATAATGGATTTGGCAATGATG GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 2842 ATGGCTATAATGGATTTGGCAATGATG<-2869:3805- >GAAGCAATT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 436 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG--tttat gcA-CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TTGGAGGTGGTGGAAGCTACAATGATTTTGGG ++ + +A CAATCA[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3815 TTGGAGGTGGTGGAAGCTACAATGATTTTGGGAATT-A- -CAACAATCA[] [34] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 482 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3861 GTCTTCAAATTTTGGACCCATGAAGGGAGGAAATTTTGG AGGCAGAAGC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 531 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3910 TCTGGCCCCTATGGCGGTGGAGGCCAATACTTTGCAAAA CCACGAAACC[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNCPA1 580 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 [] \OT1/cmtt/m/n/10 AAG GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1465--1465 []\OT1/cmtt/m/n/10 HSHNRNPA 3959 AAG<-3962:4251->GTGGCTATGGCGGTTCCAGCAGC AGCAGTAGCT[] [35] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1572--1572 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [36] [37] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1600--1600 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_MyProteinSW(seqone,seqtwo,mat,-12, -2,NULL);[] Overfull \hbox (127.49588pt too wide) in paragraph at lines 1634--1634 [] \OT1/cmtt/m/n/10 fprintf(stdout,"%d,%d are matched with score %d\n",uni t->i+1,unit->j+1,unit->score);[] [38] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1727--1727 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [39] [40] Overfull \hbox (22.4968pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 query type="MySequence*" name="query" field:len="length_of _sequence"[] Overfull \hbox (27.74675pt too wide) in paragraph at lines 1849--1849 []\OT1/cmtt/m/n/10 target type="MySequence*" name="target" field:len="length_o f_sequence"[] [41] Overfull \hbox (258.74474pt too wide) in paragraph at lines 1849--1849 [] \OT1/cmtt/m/n/10 calc="ALPHA_SEQ_SCORE(query,i) + ALPHA_SEQ_SCORE(target,j) + mat_alpha.comp[SEQ_POS(query,i)][SEQ_POS(target,j)]"[] [42] [43] Overfull \hbox (20.54509pt too wide) in paragraph at lines 1911--1912 []\OT1/cmr/m/n/10 The macro Dna-Ma-trix[]Score which is de-fined at the top of the cdna2genomic.dy Overfull \hbox (17.24684pt too wide) in paragraph at lines 1928--1928 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,i),GENOMIC_CODON(ta rget,j))"[] [44] Overfull \hbox (53.99652pt too wide) in paragraph at lines 1944--1944 [] \OT1/cmtt/m/n/10 Mis-type in argument 3 of DNA\_MAT\_SCORE: wanted [b ase] got [codon][] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1955--1955 [] \OT1/cmtt/m/n/10 calc="DNA_MAT_SCORE(dm,CDNA_BASE(query,j),GENOMIC_BASE(tar get,j))"[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 1967--1967 [] \OT1/cmtt/m/n/10 For function CDNA\_BASE, you have arguments j and qu ery, which do not[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 1967--1967 []\OT1/cmtt/m/n/10 expect to paired directly in a function. This is just a warn ing that[] [45] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",one);[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 2014--2014 [] \OT1/cmtt/m/n/10 throw_warning("Letter %c does not exist in comparison matr ix",two);[] [46] [47] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"dbsearch [options] \n");[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** add more options here sometime, eg comp matrix and gap penalty*/[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /** print out dbsearch options. We don't know here what im plementations are[] Overfull \hbox (74.99634pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 either possible or how they are specified. Of course, there is the problem[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 that we could clash our options with the dbsearchimpl options, but that[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 is not too likely, and this makes this program future proof wrt to new[] [48] Overfull \hbox (43.49661pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 * care about which implementation is used, and does not k now either (!)[] [49] Overfull \hbox (106.49606pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 /* 10 means a score cutoff of 10, -1 means don't report on stderr search progress */[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s ",query->name);[] Overfull \hbox (174.74547pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 fprintf(stdout,"Comparison to %s was %d score\n",out-> ds[i]->target->name,out->ds[i]->score);[] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [50] Overfull \hbox (69.74638pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make a protein complex sequence from %s",te mp->baseseq->name);[] Overfull \hbox (59.24648pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 pal = PackAln_bestmemory_ProteinSW(query_cs,target_cs, mat,-12,-2,NULL);[] Overfull \hbox (95.99615pt too wide) in paragraph at lines 2255--2255 []\OT1/cmtt/m/n/10 fatal("Unable to make an alignment from %s and %s",query->na me,temp->baseseq->name);[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 2255--2255 [] \OT1/cmtt/m/n/10 write_pretty_seq_align(alb,query,temp->baseseq,15,50,s tdout);[] Overfull \hbox (32.9967pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 if( search_ProteinSW(dbsi,out,querydb,prodb,mat,-12,-2) != SEARCH_OK )[] Overfull \hbox (53.99652pt too wide) in paragraph at lines 2263--2263 [] \OT1/cmtt/m/n/10 fatal("Some sort of error in the database search. Dieing ungracefully");[] [51] Overfull \hbox (1.49698pt too wide) in paragraph at lines 2292--2292 [] \OT1/cmtt/m/n/10 temp = get_Protein_from_ProteinDB(prodb,out->ds[i]->ta rget);[] [52] [53] [54] [55] [56] Overfull \hbox (1.32472pt too wide) in paragraph at lines 2528--2534 \OT1/cmr/m/n/10 de-scribed by a "state...endstate" multi-line block. Within eac h "state...endstate" [57] [58] [59] [60] [61] Overfull \hbox (1.75064pt too wide) in paragraph at lines 2772--2776 \OT1/cmr/m/n/10 Dy-na-mite file: for ex-am-ple the fol-low-ing er-ror was made by mistyp-ing ``MATCH'' Overfull \hbox (59.24648pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 In matrix ProteinSW - State MATCH asks for source MA TCH2 but there is[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 2792--2792 [] \OT1/cmtt/m/n/10 Failing simple cross-checks, aborting before calc-li ne parsing[] [62] [63] [64] (./dynamite.aux) LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on dynamite.pdf (64 pages, 217627 bytes). Transcript written on dynamite.log. cd docs && pdflatex wise2.tex This is pdfTeX, Version 3.14159265-2.6-1.40.18 (TeX Live 2017/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./wise2.tex LaTeX2e <2017-04-15> Babel <3.12> and hyphenation patterns for 3 language(s) loaded. (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2014/09/29 v1.4h Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphicx.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/keyval.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphics.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/trig.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics-cfg/graphics.cfg) (/usr/share/texlive/texmf-dist/tex/latex/graphics-def/pdftex.def))) No file wise2.aux. (/usr/share/texlive/texmf-dist/tex/context/base/mkii/supp-pdf.mkii [Loading MPS to PDF converter (version 2006.09.02).] ) (/usr/share/texlive/texmf-dist/tex/latex/oberdiek/epstopdf-base.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/infwarerr.sty) (/usr/share/texlive/texmf-dist/tex/latex/oberdiek/grfext.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/kvdefinekeys.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/ltxcmds.sty))) (/usr/share/texlive/texmf-dist/tex/latex/oberdiek/kvoptions.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/kvsetkeys.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/etexcmds.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/ifluatex.sty)))) (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/pdftexcmds.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/ifpdf.sty)) (/usr/share/texlive/texmf-dist/tex/latex/latexconfig/epstopdf-sys.cfg)) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] No file wise2.toc. [2] [3] [4] LaTeX Warning: Reference `genewise_large' on page 5 undefined on input line 110 . LaTeX Warning: Reference `estwise_large' on page 5 undefined on input line 113. Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 This program is freely distributed under a GPL. See source d irectory[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Copyright (c) GRL limited: portions of the code are from sep arate copyright[] [5] Overfull \hbox (32.9967pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Warning: The bits scores is not probablistically correct for single seqs[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 88 AQKSRPHKIDGRVVEPKRAVPRQ DID[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 A +RPHK+DGRVVEPKRAV R+ D[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 AMNARPHKVDGRVVEPKRAVSRE DSQ[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 1867 gaagaccagggagggcaaggtagGTGAGTG Intron 2 TAGgtc[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ctacgcaataggttacagctcga<0-----[1936 : 2 083]-0>aca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tgtagacggtaatgaagatccaa tta[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 114 SPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDIN IVIDKETGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 P A TVKK+FVG +K+D +E +RDYF+ +G I I I+ D+ +GKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIE IMTDRGSGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2093 acggctagaaatgggaaggaggcccagttgctgaaggag aaagcgagaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gcgcatctaatttggtaaacaaaatgaataaagatatta ttcaggggaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 aatccatgagatttctaactaatcaatttagtaatagta cgtcactcga[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 163 RGFAFVEFDDYDPVDKVV QKQHQ[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFV FDD+D VDK+V QK H[] [6] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFVTFDDHDSVDKIV L:I[att] QKYHT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2240 agtgtgatggcgtggaagAGTAAGTA Intron 3 TAGTTcatca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ggtcttctaaaactaatt <1-----[2295 : 2387] -1> aaaac[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gctctactcctccgtgtc gactt[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tagaagatgactcaaatcgcccgag <1-----[2481 : 2793][] (/usr/share/texlive/texmf-dist/tex/latex/base/omscmr.fd) [7] [8] LaTeX Warning: Reference `sec:start_end' on page 9 undefined on input line 297. [9] LaTeX Warning: Reference `half_and_blast' on page 10 undefined on input line 34 6. [10] [11] LaTeX Warning: Reference `genewise_large' on page 12 undefined on input line 45 5. LaTeX Warning: Reference `estwise_large' on page 12 undefined on input line 455 . LaTeX Warning: Reference `compile_pthread' on page 12 undefined on input line 4 66. LaTeX Warning: Reference `half_and_blast' on page 12 undefined on input line 47 3. [12] LaTeX Warning: Reference `half_and_blast' on page 13 undefined on input line 51 3. [13] [14] LaTeX Warning: Reference `running_pthread' on page 15 undefined on input line 6 13. [15] [16] [17] LaTeX Warning: Reference `Figure:genewise21' on page 18 undefined on input line 708. [18] [19] [20] LaTeX Warning: Reference `Figure:genewise623' on page 21 undefined on input lin e 900. [21] Overfull \hbox (2.03789pt too wide) in paragraph at lines 965--968 []\OT1/cmr/m/n/10 Algorithms are named in two parts, \OT1/cmr/m/it/10 descripti ve-word state-number:transition- [22] [23] [24] [25] Overfull \hbox (68.08423pt too wide) in paragraph at lines 1108--1109 []\OT1/cmr/m/n/10 The half-wise pro-tein database, found at ftp://ftp.sanger.ac .uk/pub/birney/wise2/halfwise [26] LaTeX Warning: Reference `sec:commonmode' on page 27 undefined on input line 11 81. [27] LaTeX Warning: Reference `sec:start_end' on page 28 undefined on input line 121 0. [28] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] [29] LaTeX Warning: Reference `sec:alg' on page 30 undefined on input line 1276. Overfull \hbox (36.99692pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 Bits Query start end Target start end idel s introns[] Overfull \hbox (5.4972pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 230.57 roa1_drome 26 347 HSHNRNPA 1386 3963 0 6[] [30] [31] LaTeX Warning: Reference `sec:start_end' on page 32 undefined on input line 137 7. [32] [33] [34] LaTeX Warning: Reference `sec:start_end' on page 35 undefined on input line 146 9. [35] [36] LaTeX Warning: Reference `compile_pthread' on page 37 undefined on input line 1 561. [37] [38] [39] [40] [41] [42] (./wise2.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on wise2.pdf (42 pages, 205842 bytes). Transcript written on wise2.log. cd docs && pdflatex wise2.tex This is pdfTeX, Version 3.14159265-2.6-1.40.18 (TeX Live 2017/Debian) (preloaded format=pdflatex) restricted \write18 enabled. entering extended mode (./wise2.tex LaTeX2e <2017-04-15> Babel <3.12> and hyphenation patterns for 3 language(s) loaded. (/usr/share/texlive/texmf-dist/tex/latex/base/article.cls Document Class: article 2014/09/29 v1.4h Standard LaTeX document class (/usr/share/texlive/texmf-dist/tex/latex/base/size10.clo)) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphicx.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/keyval.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics/graphics.sty (/usr/share/texlive/texmf-dist/tex/latex/graphics/trig.sty) (/usr/share/texlive/texmf-dist/tex/latex/graphics-cfg/graphics.cfg) (/usr/share/texlive/texmf-dist/tex/latex/graphics-def/pdftex.def))) (./wise2.aux) (/usr/share/texlive/texmf-dist/tex/context/base/mkii/supp-pdf.mkii [Loading MPS to PDF converter (version 2006.09.02).] ) (/usr/share/texlive/texmf-dist/tex/latex/oberdiek/epstopdf-base.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/infwarerr.sty) (/usr/share/texlive/texmf-dist/tex/latex/oberdiek/grfext.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/kvdefinekeys.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/ltxcmds.sty))) (/usr/share/texlive/texmf-dist/tex/latex/oberdiek/kvoptions.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/kvsetkeys.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/etexcmds.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/ifluatex.sty)))) (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/pdftexcmds.sty (/usr/share/texlive/texmf-dist/tex/generic/oberdiek/ifpdf.sty)) (/usr/share/texlive/texmf-dist/tex/latex/latexconfig/epstopdf-sys.cfg)) [1{/var/lib/texmf/fonts/map/pdftex/updmap/pdftex.map}] (./wise2.toc [2]) [3] [4] [5] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 This program is freely distributed under a GPL. See source d irectory[] Overfull \hbox (48.74657pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Copyright (c) GRL limited: portions of the code are from sep arate copyright[] [6] Overfull \hbox (32.9967pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 Warning: The bits scores is not probablistically correct for single seqs[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 88 AQKSRPHKIDGRVVEPKRAVPRQ DID[] Overfull \hbox (11.99689pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 A +RPHK+DGRVVEPKRAV R+ D[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 AMNARPHKVDGRVVEPKRAVSRE DSQ[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 1867 gaagaccagggagggcaaggtagGTGAGTG Intron 2 TAGgtc[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ctacgcaataggttacagctcga<0-----[1936 : 2 083]-0>aca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tgtagacggtaatgaagatccaa tta[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 114 SPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDIN IVIDKETGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 P A TVKK+FVG +K+D +E +RDYF+ +G I I I+ D+ +GKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIE IMTDRGSGKK[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2093 acggctagaaatgggaaggaggcccagttgctgaaggag aaagcgagaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gcgcatctaatttggtaaacaaaatgaataaagatatta ttcaggggaa[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 aatccatgagatttctaactaatcaatttagtaatagta cgtcactcga[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 roa1_drome 163 RGFAFVEFDDYDPVDKVV QKQHQ[] Overfull \hbox (17.24684pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFV FDD+D VDK+V QK H[] [7] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 RGFAFVTFDDHDSVDKIV L:I[att] QKYHT[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 []\OT1/cmtt/m/n/10 HSHNRNPA 2240 agtgtgatggcgtggaagAGTAAGTA Intron 3 TAGTTcatca[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 ggtcttctaaaactaatt <1-----[2295 : 2387] -1> aaaac[] Overfull \hbox (22.4968pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 gctctactcctccgtgtc gactt[] Overfull \hbox (6.74693pt too wide) in paragraph at lines 206--206 [] \OT1/cmtt/m/n/10 tagaagatgactcaaatcgcccgag <1-----[2481 : 2793][] (/usr/share/texlive/texmf-dist/tex/latex/base/omscmr.fd) [8] [9] [10] [11] [12] [13] [14] [15] [16] [17] [18] LaTeX Warning: Reference `Figure:genewise21' on page 19 undefined on input line 708. [19] [20] [21] [22] Overfull \hbox (2.03789pt too wide) in paragraph at lines 965--968 []\OT1/cmr/m/n/10 Algorithms are named in two parts, \OT1/cmr/m/it/10 descripti ve-word state-number:transition- [23] [24] [25] [26] Overfull \hbox (68.08423pt too wide) in paragraph at lines 1108--1109 []\OT1/cmr/m/n/10 The half-wise pro-tein database, found at ftp://ftp.sanger.ac .uk/pub/birney/wise2/halfwise [27] [28] [29] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] Overfull \hbox (42.24687pt too wide) in paragraph at lines 1268--1268 []\OT1/cmtt/m/n/10 pexon [] [30] Overfull \hbox (36.99692pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 Bits Query start end Target start end idel s introns[] Overfull \hbox (5.4972pt too wide) in paragraph at lines 1312--1312 []\OT1/cmtt/m/n/10 230.57 roa1_drome 26 347 HSHNRNPA 1386 3963 0 6[] [31] [32] [33] [34] [35] [36] [37] [38] [39] [40] [41] [42] [43] (./wise2.aux) LaTeX Warning: There were undefined references. LaTeX Warning: Label(s) may have changed. Rerun to get cross-references right. ) (see the transcript file for additional information) Output written on wise2.pdf (43 pages, 208368 bytes). Transcript written on wise2.log. cd docs && hevea api.tex ./api.tex:2: Warning: Command not found: \pdftrailerid ./api.tex:233: Warning: Undefined label: 'object_GeneFrequency' ./api.tex:236: Warning: Undefined label: 'module_gwrap' ./api.tex:237: Warning: Undefined label: 'module_gwrap' ./api.tex:238: Warning: Undefined label: 'module_gwrap' ./api.tex:239: Warning: Undefined label: 'module_gwrap' ./api.tex:389: Warning: Undefined label: 'module_gwrap' ./api.tex:426: Warning: Undefined label: 'module_codonmat' ./api.tex:435: Warning: Undefined label: 'module_dbimpl' ./api.tex:476: Warning: Application of '\'' on ',' failed ./api.tex:629: Warning: Application of '\'' on 't' failed ./api.tex:631: Warning: Application of '\'' on 'b' failed ./api.tex:633: Warning: Application of '\'' on 'b' failed ./api.tex:1642: Warning: Application of '\'' on 't' failed ./api.tex:1660: Warning: Application of '\'' on 't' failed ./api.tex:1882: Warning: Application of '\'' on '.' failed ./api.tex:2441: Warning: Application of '\'' on 'b' failed ./api.tex:2847: Warning: Application of '\'' on 'h' failed ./api.tex:2847: Warning: Application of '\'' on 't' failed ./api.tex:4435: Warning: Application of '\'' on '.' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:5809: Warning: Application of '\'' on 'f' failed ./api.tex:5809: Warning: Application of '\'' on '[' failed ./api.tex:5830: Warning: Application of '\'' on 'f' failed ./api.tex:5830: Warning: Application of '\'' on '[' failed cd docs && hevea api.tex ./api.tex:2: Warning: Command not found: \pdftrailerid ./api.tex:233: Warning: Undefined label: 'object_GeneFrequency' ./api.tex:236: Warning: Undefined label: 'module_gwrap' ./api.tex:237: Warning: Undefined label: 'module_gwrap' ./api.tex:238: Warning: Undefined label: 'module_gwrap' ./api.tex:239: Warning: Undefined label: 'module_gwrap' ./api.tex:389: Warning: Undefined label: 'module_gwrap' ./api.tex:426: Warning: Undefined label: 'module_codonmat' ./api.tex:435: Warning: Undefined label: 'module_dbimpl' ./api.tex:476: Warning: Application of '\'' on ',' failed ./api.tex:629: Warning: Application of '\'' on 't' failed ./api.tex:631: Warning: Application of '\'' on 'b' failed ./api.tex:633: Warning: Application of '\'' on 'b' failed ./api.tex:1642: Warning: Application of '\'' on 't' failed ./api.tex:1660: Warning: Application of '\'' on 't' failed ./api.tex:1882: Warning: Application of '\'' on '.' failed ./api.tex:2441: Warning: Application of '\'' on 'b' failed ./api.tex:2847: Warning: Application of '\'' on 'h' failed ./api.tex:2847: Warning: Application of '\'' on 't' failed ./api.tex:4435: Warning: Application of '\'' on '.' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:4952: Warning: Application of '\'' on 'd' failed ./api.tex:5809: Warning: Application of '\'' on 'f' failed ./api.tex:5809: Warning: Application of '\'' on '[' failed ./api.tex:5830: Warning: Application of '\'' on 'f' failed ./api.tex:5830: Warning: Application of '\'' on '[' failed cd docs && hevea dynamite.tex ./dynamite.tex:2: Warning: Command not found: \pdftrailerid ./dynamite.tex:2618: Warning: Command not found: \+ ./dynamite.tex:2618: Warning: Command not found: \* ./dynamite.tex:2619: Warning: Command not found: \* ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed cd docs && hevea dynamite.tex ./dynamite.tex:2: Warning: Command not found: \pdftrailerid ./dynamite.tex:2618: Warning: Command not found: \+ ./dynamite.tex:2618: Warning: Command not found: \* ./dynamite.tex:2619: Warning: Command not found: \* ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed ./dynamite.tex:2756: Warning: Application of '\"' on ')' failed cd docs && hevea wise2.tex ./wise2.tex:3: Warning: Command not found: \pdftrailerid ./wise2.tex:241: Warning: \hbox ./wise2.tex:243: Warning: \hbox ./wise2.tex:245: Warning: \hbox ./wise2.tex:247: Warning: \hbox ./wise2.tex:249: Warning: \hbox ./wise2.tex:251: Warning: \hbox ./wise2.tex:253: Warning: \hbox ./wise2.tex:255: Warning: \hbox ./wise2.tex:263: Warning: \hbox ./wise2.tex:265: Warning: \hbox ./wise2.tex:267: Warning: \hbox ./wise2.tex:269: Warning: \hbox ./wise2.tex:271: Warning: \hbox ./wise2.tex:273: Warning: \hbox ./wise2.tex:275: Warning: \hbox ./wise2.tex:277: Warning: \hbox ./wise2.tex:708: Warning: Undefined label: 'Figure:genewise21' ./wise2.tex:712: Warning: Command not found: \leavevmode ./wise2.tex:904: Warning: Command not found: \leavevmode cd docs && hevea wise2.tex ./wise2.tex:3: Warning: Command not found: \pdftrailerid ./wise2.tex:241: Warning: \hbox ./wise2.tex:243: Warning: \hbox ./wise2.tex:245: Warning: \hbox ./wise2.tex:247: Warning: \hbox ./wise2.tex:249: Warning: \hbox ./wise2.tex:251: Warning: \hbox ./wise2.tex:253: Warning: \hbox ./wise2.tex:255: Warning: \hbox ./wise2.tex:263: Warning: \hbox ./wise2.tex:265: Warning: \hbox ./wise2.tex:267: Warning: \hbox ./wise2.tex:269: Warning: \hbox ./wise2.tex:271: Warning: \hbox ./wise2.tex:273: Warning: \hbox ./wise2.tex:275: Warning: \hbox ./wise2.tex:277: Warning: \hbox ./wise2.tex:708: Warning: Undefined label: 'Figure:genewise21' ./wise2.tex:712: Warning: Command not found: \leavevmode ./wise2.tex:904: Warning: Command not found: \leavevmode mkdir -p docs/api mkdir -p docs/dynamite mkdir -p docs/wise2 mv docs/api.html docs/api mv docs/dynamite.html docs/dynamite mv docs/wise2.html docs/wise2 dh_auto_build make[1]: Leaving directory '/<>' rm -f debian/wise.debhelper.log debian/rules override_dh_auto_test make[1]: Entering directory '/<>' echo "Since a patch was used to adapt the binaries to the Debian locations of data files the test suite will not run in the build directory any more." Since a patch was used to adapt the binaries to the Debian locations of data files the test suite will not run in the build directory any more. echo "A autopkgtest was added as compensation." A autopkgtest was added as compensation. # make -C src test make[1]: Leaving directory '/<>' create-stamp debian/debhelper-build-stamp fakeroot debian/rules binary-arch dh binary-arch dh_testroot -a dh_prep -a rm -f -- debian/wise.substvars rm -fr -- debian/.debhelper/generated/wise/ debian/wise/ debian/tmp/ dh_installdirs -a install -d debian/wise install -d debian/wise/usr/bin dh_auto_install -a dh_install -a cp --reflink=auto -a ./src/bin/dba ./src/bin/dnal ./src/bin/estwise ./src/bin/estwisedb ./src/bin/genewise ./src/bin/genewisedb ./src/bin/promoterwise ./src/bin/psw ./src/bin/pswdb ./src/bin/scanwise ./src/bin/scanwise_server ./src/models/genomewise debian/wise/usr/bin/ install -d debian/.debhelper/generated/wise install -d debian/.debhelper/generated/wise-doc install -d debian/.debhelper/generated/wise-data dh_installdocs -a install -d debian/wise/usr/share/doc/wise cp --reflink=auto -a ./README debian/wise/usr/share/doc/wise cp --reflink=auto -a ./debian/tests/run-unit-test debian/wise/usr/share/doc/wise chown -R 0:0 debian/wise/usr/share/doc chmod -R u\+rw,go=rX debian/wise/usr/share/doc install -p -m0644 debian/README.Debian debian/wise/usr/share/doc/wise/README.Debian install -p -m0644 debian/copyright debian/wise/usr/share/doc/wise/copyright dh_installchangelogs -a install -p -m0644 debian/changelog debian/wise/usr/share/doc/wise/changelog.Debian dh_installexamples -a dh_installman -a install -d debian/wise/usr/share/man/man1/ install -p -m0644 ./debian/manpages.d/dba.1 debian/wise/usr/share/man/man1/dba.1 install -p -m0644 ./debian/manpages.d/dnal.1 debian/wise/usr/share/man/man1/dnal.1 install -p -m0644 ./debian/manpages.d/estwise.1 debian/wise/usr/share/man/man1/estwise.1 install -p -m0644 ./debian/manpages.d/estwisedb.1 debian/wise/usr/share/man/man1/estwisedb.1 install -p -m0644 ./debian/manpages.d/genewise.1 debian/wise/usr/share/man/man1/genewise.1 install -p -m0644 ./debian/manpages.d/genewisedb.1 debian/wise/usr/share/man/man1/genewisedb.1 install -p -m0644 ./debian/manpages.d/genomewise.1 debian/wise/usr/share/man/man1/genomewise.1 install -p -m0644 ./debian/manpages.d/promoterwise.1 debian/wise/usr/share/man/man1/promoterwise.1 install -p -m0644 ./debian/manpages.d/psw.1 debian/wise/usr/share/man/man1/psw.1 install -p -m0644 ./debian/manpages.d/pswdb.1 debian/wise/usr/share/man/man1/pswdb.1 install -p -m0644 ./debian/manpages.d/scanwise.1 debian/wise/usr/share/man/man1/scanwise.1 install -p -m0644 ./debian/manpages.d/scanwise_server.1 debian/wise/usr/share/man/man1/scanwise_server.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/dba.1 > debian/wise/usr/share/man/man1/dba.1.dh-new man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/genewisedb.1 > debian/wise/usr/share/man/man1/genewisedb.1.dh-new man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/scanwise_server.1 > debian/wise/usr/share/man/man1/scanwise_server.1.dh-new man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/pswdb.1 > debian/wise/usr/share/man/man1/pswdb.1.dh-new mv debian/wise/usr/share/man/man1/dba.1.dh-new debian/wise/usr/share/man/man1/dba.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/scanwise.1 > debian/wise/usr/share/man/man1/scanwise.1.dh-new mv debian/wise/usr/share/man/man1/scanwise_server.1.dh-new debian/wise/usr/share/man/man1/scanwise_server.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/estwisedb.1 > debian/wise/usr/share/man/man1/estwisedb.1.dh-new mv debian/wise/usr/share/man/man1/pswdb.1.dh-new debian/wise/usr/share/man/man1/pswdb.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/dnal.1 > debian/wise/usr/share/man/man1/dnal.1.dh-new mv debian/wise/usr/share/man/man1/genewisedb.1.dh-new debian/wise/usr/share/man/man1/genewisedb.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/genewise.1 > debian/wise/usr/share/man/man1/genewise.1.dh-new mv debian/wise/usr/share/man/man1/estwisedb.1.dh-new debian/wise/usr/share/man/man1/estwisedb.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/psw.1 > debian/wise/usr/share/man/man1/psw.1.dh-new mv debian/wise/usr/share/man/man1/scanwise.1.dh-new debian/wise/usr/share/man/man1/scanwise.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/promoterwise.1 > debian/wise/usr/share/man/man1/promoterwise.1.dh-new mv debian/wise/usr/share/man/man1/dnal.1.dh-new debian/wise/usr/share/man/man1/dnal.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/genomewise.1 > debian/wise/usr/share/man/man1/genomewise.1.dh-new mv debian/wise/usr/share/man/man1/genewise.1.dh-new debian/wise/usr/share/man/man1/genewise.1 man -l --recode UTF-8 ./debian/wise/usr/share/man/man1/estwise.1 > debian/wise/usr/share/man/man1/estwise.1.dh-new mv debian/wise/usr/share/man/man1/psw.1.dh-new debian/wise/usr/share/man/man1/psw.1 chmod 0644 -- debian/wise/usr/share/man/man1/scanwise_server.1 debian/wise/usr/share/man/man1/estwisedb.1 debian/wise/usr/share/man/man1/psw.1 mv debian/wise/usr/share/man/man1/promoterwise.1.dh-new debian/wise/usr/share/man/man1/promoterwise.1 chmod 0644 -- debian/wise/usr/share/man/man1/dba.1 debian/wise/usr/share/man/man1/scanwise.1 debian/wise/usr/share/man/man1/promoterwise.1 mv debian/wise/usr/share/man/man1/genomewise.1.dh-new debian/wise/usr/share/man/man1/genomewise.1 chmod 0644 -- debian/wise/usr/share/man/man1/pswdb.1 debian/wise/usr/share/man/man1/dnal.1 debian/wise/usr/share/man/man1/genomewise.1 mv debian/wise/usr/share/man/man1/estwise.1.dh-new debian/wise/usr/share/man/man1/estwise.1 chmod 0644 -- debian/wise/usr/share/man/man1/genewisedb.1 debian/wise/usr/share/man/man1/genewise.1 debian/wise/usr/share/man/man1/estwise.1 dh_perl -a dh_link -a dh_strip_nondeterminism -a dh_compress -a cd debian/wise chmod a-x usr/share/doc/wise/changelog.Debian usr/share/man/man1/dba.1 usr/share/man/man1/dnal.1 usr/share/man/man1/estwise.1 usr/share/man/man1/estwisedb.1 usr/share/man/man1/genewise.1 usr/share/man/man1/genewisedb.1 usr/share/man/man1/genomewise.1 usr/share/man/man1/promoterwise.1 usr/share/man/man1/psw.1 usr/share/man/man1/pswdb.1 usr/share/man/man1/scanwise.1 usr/share/man/man1/scanwise_server.1 gzip -9nf usr/share/doc/wise/changelog.Debian usr/share/man/man1/dba.1 usr/share/man/man1/dnal.1 usr/share/man/man1/estwise.1 usr/share/man/man1/estwisedb.1 usr/share/man/man1/genewise.1 usr/share/man/man1/genewisedb.1 usr/share/man/man1/genomewise.1 usr/share/man/man1/promoterwise.1 usr/share/man/man1/psw.1 usr/share/man/man1/pswdb.1 usr/share/man/man1/scanwise.1 usr/share/man/man1/scanwise_server.1 cd '/<>' dh_fixperms -a find debian/wise -true -print0 2>/dev/null | xargs -0r chown --no-dereference 0:0 find debian/wise ! -type l -a -true -a -true -print0 2>/dev/null | xargs -0r chmod go=rX,u+rw,a-s find debian/wise/usr/share/doc -type f -a -true -a ! -regex 'debian/wise/usr/share/doc/[^/]*/examples/.*' -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise/usr/share/doc -type d -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0755 find debian/wise/usr/share/man -type f -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise -type f \( -name '*.so.*' -o -name '*.so' -o -name '*.la' -o -name '*.a' -o -name '*.js' -o -name '*.css' -o -name '*.scss' -o -name '*.sass' -o -name '*.jpeg' -o -name '*.jpg' -o -name '*.png' -o -name '*.gif' -o -name '*.cmxs' \) -a -true -a -true -print0 2>/dev/null | xargs -0r chmod 0644 find debian/wise/usr/bin -type f -a -true -a -true -print0 2>/dev/null | xargs -0r chmod a+x dh_missing -a dh_strip -a install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8b objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/scanwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8b/8da7775737ca26271be1c87b641654b38561d0.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8b/8da7775737ca26271be1c87b641654b38561d0.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8b/8da7775737ca26271be1c87b641654b38561d0.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/scanwise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8b/8da7775737ca26271be1c87b641654b38561d0.debug debian/wise/usr/bin/scanwise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/57 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/dba debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/57/d1d5598cca04c6311a17acb12b50aacb0c079c.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/57/d1d5598cca04c6311a17acb12b50aacb0c079c.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/57/d1d5598cca04c6311a17acb12b50aacb0c079c.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/dba objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/57/d1d5598cca04c6311a17acb12b50aacb0c079c.debug debian/wise/usr/bin/dba install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/99 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/promoterwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/99/81f06752241294ab336618212475aa420c7eb4.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/99/81f06752241294ab336618212475aa420c7eb4.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/99/81f06752241294ab336618212475aa420c7eb4.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/promoterwise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/99/81f06752241294ab336618212475aa420c7eb4.debug debian/wise/usr/bin/promoterwise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/82 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genewise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/82/90d0781017e28a92bc8b8e6b46fc11180c018b.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/82/90d0781017e28a92bc8b8e6b46fc11180c018b.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/82/90d0781017e28a92bc8b8e6b46fc11180c018b.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/genewise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/82/90d0781017e28a92bc8b8e6b46fc11180c018b.debug debian/wise/usr/bin/genewise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/60 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/psw debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/60/c4a394e8660be6c4d0625400785742103735ce.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/60/c4a394e8660be6c4d0625400785742103735ce.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/60/c4a394e8660be6c4d0625400785742103735ce.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/psw objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/60/c4a394e8660be6c4d0625400785742103735ce.debug debian/wise/usr/bin/psw install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/62 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/scanwise_server debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/62/1c94a67cf82f24286240a66c1d9241210fab24.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/62/1c94a67cf82f24286240a66c1d9241210fab24.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/62/1c94a67cf82f24286240a66c1d9241210fab24.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/scanwise_server objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/62/1c94a67cf82f24286240a66c1d9241210fab24.debug debian/wise/usr/bin/scanwise_server install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/90 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genomewise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/90/444192972fdcd81cab780174465a70731c5b56.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/90/444192972fdcd81cab780174465a70731c5b56.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/90/444192972fdcd81cab780174465a70731c5b56.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/genomewise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/90/444192972fdcd81cab780174465a70731c5b56.debug debian/wise/usr/bin/genomewise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a8 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/genewisedb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a8/acc73e2bf755ac564efe8e5629825a35a319bc.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a8/acc73e2bf755ac564efe8e5629825a35a319bc.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a8/acc73e2bf755ac564efe8e5629825a35a319bc.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/genewisedb objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/a8/acc73e2bf755ac564efe8e5629825a35a319bc.debug debian/wise/usr/bin/genewisedb install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/f8 objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/pswdb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/f8/bda5225a631f27c9d9f03e3a1e15549d5d1de0.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/f8/bda5225a631f27c9d9f03e3a1e15549d5d1de0.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/f8/bda5225a631f27c9d9f03e3a1e15549d5d1de0.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/pswdb objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/f8/bda5225a631f27c9d9f03e3a1e15549d5d1de0.debug debian/wise/usr/bin/pswdb install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8d objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/estwise debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8d/dac7433ac48359d21a0ded45f7137381f5caa4.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8d/dac7433ac48359d21a0ded45f7137381f5caa4.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8d/dac7433ac48359d21a0ded45f7137381f5caa4.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/estwise objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/8d/dac7433ac48359d21a0ded45f7137381f5caa4.debug debian/wise/usr/bin/estwise install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ce objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/estwisedb debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ce/bc1d16eaa3eb0ad80530acbec9fe3f90abf7eb.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ce/bc1d16eaa3eb0ad80530acbec9fe3f90abf7eb.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ce/bc1d16eaa3eb0ad80530acbec9fe3f90abf7eb.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/estwisedb objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/ce/bc1d16eaa3eb0ad80530acbec9fe3f90abf7eb.debug debian/wise/usr/bin/estwisedb install -d debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/4b objcopy --only-keep-debug --compress-debug-sections debian/wise/usr/bin/dnal debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/4b/1aea9ca388ad8dd674acdec1c8f4701c031fb7.debug chmod 0644 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/4b/1aea9ca388ad8dd674acdec1c8f4701c031fb7.debug chown 0:0 -- debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/4b/1aea9ca388ad8dd674acdec1c8f4701c031fb7.debug strip --remove-section=.comment --remove-section=.note debian/wise/usr/bin/dnal objcopy --add-gnu-debuglink debian/.debhelper/wise/dbgsym-root/usr/lib/debug/.build-id/4b/1aea9ca388ad8dd674acdec1c8f4701c031fb7.debug debian/wise/usr/bin/dnal install -d debian/.debhelper/wise/dbgsym-root/usr/share/doc ln -s wise debian/.debhelper/wise/dbgsym-root/usr/share/doc/wise-dbgsym dh_makeshlibs -a rm -f debian/wise/DEBIAN/shlibs dh_shlibdeps -a install -d debian/wise/DEBIAN dpkg-shlibdeps -Tdebian/wise.substvars debian/wise/usr/bin/scanwise debian/wise/usr/bin/dba debian/wise/usr/bin/promoterwise debian/wise/usr/bin/genewise debian/wise/usr/bin/psw debian/wise/usr/bin/scanwise_server debian/wise/usr/bin/genomewise debian/wise/usr/bin/genewisedb debian/wise/usr/bin/pswdb debian/wise/usr/bin/estwise debian/wise/usr/bin/estwisedb debian/wise/usr/bin/dnal dh_installdeb -a dh_gencontrol -a echo misc:Depends= >> debian/wise.substvars echo misc:Pre-Depends= >> debian/wise.substvars install -d debian/.debhelper/wise/dbgsym-root/DEBIAN dpkg-gencontrol -pwise -ldebian/changelog -Tdebian/wise.substvars -Pdebian/.debhelper/wise/dbgsym-root -UPre-Depends -URecommends -USuggests -UEnhances -UProvides -UEssential -UConflicts -DPriority=optional -UHomepage -UImportant -DAuto-Built-Package=debug-symbols -DPackage=wise-dbgsym "-DDepends=wise (= \${binary:Version})" "-DDescription=debug symbols for wise" "-DBuild-Ids=4b1aea9ca388ad8dd674acdec1c8f4701c031fb7 57d1d5598cca04c6311a17acb12b50aacb0c079c 60c4a394e8660be6c4d0625400785742103735ce 621c94a67cf82f24286240a66c1d9241210fab24 8290d0781017e28a92bc8b8e6b46fc11180c018b 8b8da7775737ca26271be1c87b641654b38561d0 8ddac7433ac48359d21a0ded45f7137381f5caa4 90444192972fdcd81cab780174465a70731c5b56 9981f06752241294ab336618212475aa420c7eb4 a8acc73e2bf755ac564efe8e5629825a35a319bc cebc1d16eaa3eb0ad80530acbec9fe3f90abf7eb f8bda5225a631f27c9d9f03e3a1e15549d5d1de0" -DSection=debug -DPackage-Type=ddeb -UMulti-Arch -UReplaces -UBreaks chmod 0644 -- debian/.debhelper/wise/dbgsym-root/DEBIAN/control chown 0:0 -- debian/.debhelper/wise/dbgsym-root/DEBIAN/control dpkg-gencontrol -pwise -ldebian/changelog -Tdebian/wise.substvars -Pdebian/wise -UMulti-Arch chmod 0644 -- debian/wise/DEBIAN/control chown 0:0 -- debian/wise/DEBIAN/control dh_md5sums -a (cd debian/wise >/dev/null ; find . -type f ! -regex './DEBIAN/.*' -printf '%P\0' | LC_ALL=C sort -z | xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums) >/dev/null chmod 0644 -- debian/wise/DEBIAN/md5sums chown 0:0 -- debian/wise/DEBIAN/md5sums (cd debian/.debhelper/wise/dbgsym-root >/dev/null ; find . -type f ! -regex './DEBIAN/.*' -printf '%P\0' | LC_ALL=C sort -z | xargs -r0 md5sum | perl -pe 'if (s@^\\@@) { s/\\\\/\\/g; }' > DEBIAN/md5sums) >/dev/null chmod 0644 -- debian/.debhelper/wise/dbgsym-root/DEBIAN/md5sums chown 0:0 -- debian/.debhelper/wise/dbgsym-root/DEBIAN/md5sums dh_builddeb -a dpkg-deb --build debian/wise .. install -d debian/.debhelper/scratch-space/build-wise dpkg-deb --build debian/.debhelper/wise/dbgsym-root debian/.debhelper/scratch-space/build-wise INFO: pkgstriptranslations version 131 INFO: pkgstriptranslations version 131 pkgstriptranslations: processing wise-dbgsym (in debian/.debhelper/wise/dbgsym-root); do_strip: , oemstrip: pkgstriptranslations: processing wise (in debian/wise); do_strip: , oemstrip: pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " pkgmaintainermangler: Maintainer field overridden to "Ubuntu Developers " pkgstripfiles: processing control file: debian/.debhelper/wise/dbgsym-root/DEBIAN/control, package wise-dbgsym, directory debian/.debhelper/wise/dbgsym-root pkgstripfiles: Running PNG optimization (using 4 cpus) for package wise-dbgsym ... pkgstripfiles: No PNG files. dpkg-deb: building package 'wise-dbgsym' in 'debian/.debhelper/scratch-space/build-wise/wise-dbgsym_2.4.1-20_ppc64el.deb'. pkgstripfiles: processing control file: debian/wise/DEBIAN/control, package wise, directory debian/wise pkgstripfiles: Truncating usr/share/doc/wise/changelog.Debian.gz to topmost ten records pkgstripfiles: Running PNG optimization (using 4 cpus) for package wise ... pkgstripfiles: No PNG files. dpkg-deb: building package 'wise' in '../wise_2.4.1-20_ppc64el.deb'. Renaming wise-dbgsym_2.4.1-20_ppc64el.deb to wise-dbgsym_2.4.1-20_ppc64el.ddeb mv debian/.debhelper/scratch-space/build-wise/wise-dbgsym_2.4.1-20_ppc64el.deb ../wise-dbgsym_2.4.1-20_ppc64el.ddeb dpkg-genbuildinfo --build=any dpkg-genchanges --build=any -mLaunchpad Build Daemon >../wise_2.4.1-20_ppc64el.changes dpkg-genchanges: info: binary-only arch-specific upload (source code and arch-indep packages not included) dpkg-source --after-build wise-2.4.1 dpkg-buildpackage: info: binary-only upload (no source included) -------------------------------------------------------------------------------- Build finished at 20171101-1720 Finished -------- I: Built successfully +------------------------------------------------------------------------------+ | Post Build Chroot | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Changes | +------------------------------------------------------------------------------+ wise_2.4.1-20_ppc64el.changes: ------------------------------ Format: 1.8 Date: Fri, 22 Sep 2017 10:37:28 +0200 Source: wise Binary: wise wise-doc wise-data Architecture: ppc64el Version: 2.4.1-20 Distribution: bionic-proposed Urgency: medium Maintainer: Launchpad Build Daemon Changed-By: Andreas Tille Description: wise - comparison of biopolymers, like DNA and protein sequences wise-data - data files for the wise package wise-doc - documentation for the wise package Changes: wise (2.4.1-20) unstable; urgency=medium . * Moved packaging from SVN to Git * debhelper 10 * Standards-Version: 4.1.0 (no changes needed) * d/rules: do not parse d/changelog * spelling Checksums-Sha1: 9639baebddf6a32d665e41c801b5f31d67636ec9 10407784 wise-dbgsym_2.4.1-20_ppc64el.ddeb 4ed52fd70d5a7c73c0e18e0ee30d0e46189d8470 8829 wise_2.4.1-20_ppc64el.buildinfo ec14f1006821f717a4f66a59cf449874a3903542 1248436 wise_2.4.1-20_ppc64el.deb Checksums-Sha256: 3573a71590b8d44a3d175473e25f18a9cd70b2029259eab85e66a3d4fc4c6e10 10407784 wise-dbgsym_2.4.1-20_ppc64el.ddeb 046372a8824df24e745e508773240325f61bf82ba7f7b0aee0b94e1959d06f0a 8829 wise_2.4.1-20_ppc64el.buildinfo 72f4b69622918d343efa85ce4fb30c14675a93d013d177b88ec59f22c0588764 1248436 wise_2.4.1-20_ppc64el.deb Files: 121e2481ce598e21b61bf37b71da4cbe 10407784 debug optional wise-dbgsym_2.4.1-20_ppc64el.ddeb f3e2f403d7c928d51e4ecf958e3fe083 8829 science optional wise_2.4.1-20_ppc64el.buildinfo 0dbae547ac35a6eb03e730678b0de0f1 1248436 science optional wise_2.4.1-20_ppc64el.deb +------------------------------------------------------------------------------+ | Package contents | +------------------------------------------------------------------------------+ wise_2.4.1-20_ppc64el.deb ------------------------- new debian package, version 2.0. size 1248436 bytes: control archive=2004 bytes. 1801 bytes, 34 lines control 1742 bytes, 29 lines md5sums Package: wise Version: 2.4.1-20 Architecture: ppc64el Maintainer: Ubuntu Developers Original-Maintainer: Debian Med Packaging Team Installed-Size: 14861 Depends: libc6 (>= 2.23), libglib2.0-0 (>= 2.12.0), wise-data (= 2.4.1-20) Suggests: wise-doc (= 2.4.1-20) Section: science Priority: optional Homepage: http://www.ebi.ac.uk/~birney/wise2/ Description: comparison of biopolymers, like DNA and protein sequences Wise2 is a package focused on comparisons of biopolymers, commonly DNA and protein sequences. There are many other packages which do this, probably the best known being BLAST package (from NCBI) and the Fasta package (from Bill Pearson). There are other packages, such as the HMMER package (Sean Eddy) or SAM package (UC Santa Cruz) focused on hidden Markov models (HMMs) of biopolymers. . Wise2's particular forte is the comparison of DNA sequence at the level of its protein translation. This comparison allows the simultaneous prediction of say gene structure with homology based alignment. . Wise2 also contains other algorithms, such as the venerable Smith-Waterman algorithm, or more modern ones such as Stephen Altschul's generalised gap penalties, or even experimental ones developed in house, such as dba. The development of these algorithms is due to the ease of developing such algorithms in the environment used by Wise2. . Wise2 has also been written with an eye for reuse and maintainability. Although it is a pure C package you can access its functionality directly in Perl. Parts of the package (or the entire package) can be used by other C or C++ programs without namespace clashes as all externally linked variables have the unique identifier Wise2 prepended. drwxr-xr-x root/root 0 2017-09-22 08:37 ./ drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/ drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/bin/ -rwxr-xr-x root/root 526496 2017-09-22 08:37 ./usr/bin/dba -rwxr-xr-x root/root 329824 2017-09-22 08:37 ./usr/bin/dnal -rwxr-xr-x root/root 2756744 2017-09-22 08:37 ./usr/bin/estwise -rwxr-xr-x root/root 2756856 2017-09-22 08:37 ./usr/bin/estwisedb -rwxr-xr-x root/root 2756840 2017-09-22 08:37 ./usr/bin/genewise -rwxr-xr-x root/root 2822456 2017-09-22 08:37 ./usr/bin/genewisedb -rwxr-xr-x root/root 591936 2017-09-22 08:37 ./usr/bin/genomewise -rwxr-xr-x root/root 591968 2017-09-22 08:37 ./usr/bin/promoterwise -rwxr-xr-x root/root 460896 2017-09-22 08:37 ./usr/bin/psw -rwxr-xr-x root/root 526512 2017-09-22 08:37 ./usr/bin/pswdb -rwxr-xr-x root/root 723040 2017-09-22 08:37 ./usr/bin/scanwise -rwxr-xr-x root/root 329808 2017-09-22 08:37 ./usr/bin/scanwise_server drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/share/ drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/share/doc/ drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/share/doc/wise/ -rw-r--r-- root/root 1973 2007-07-01 20:46 ./usr/share/doc/wise/README -rw-r--r-- root/root 320 2017-09-22 08:37 ./usr/share/doc/wise/README.Debian -rw-r--r-- root/root 1391 2017-09-22 08:37 ./usr/share/doc/wise/changelog.Debian.gz -rw-r--r-- root/root 4278 2017-09-22 08:37 ./usr/share/doc/wise/copyright -rw-r--r-- root/root 229 2017-09-22 08:37 ./usr/share/doc/wise/run-unit-test drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/share/man/ drwxr-xr-x root/root 0 2017-09-22 08:37 ./usr/share/man/man1/ -rw-r--r-- root/root 846 2017-09-22 08:37 ./usr/share/man/man1/dba.1.gz -rw-r--r-- root/root 557 2017-09-22 08:37 ./usr/share/man/man1/dnal.1.gz -rw-r--r-- root/root 595 2017-09-22 08:37 ./usr/share/man/man1/estwise.1.gz -rw-r--r-- root/root 594 2017-09-22 08:37 ./usr/share/man/man1/estwisedb.1.gz -rw-r--r-- root/root 594 2017-09-22 08:37 ./usr/share/man/man1/genewise.1.gz -rw-r--r-- root/root 595 2017-09-22 08:37 ./usr/share/man/man1/genewisedb.1.gz -rw-r--r-- root/root 605 2017-09-22 08:37 ./usr/share/man/man1/genomewise.1.gz -rw-r--r-- root/root 592 2017-09-22 08:37 ./usr/share/man/man1/promoterwise.1.gz -rw-r--r-- root/root 685 2017-09-22 08:37 ./usr/share/man/man1/psw.1.gz -rw-r--r-- root/root 585 2017-09-22 08:37 ./usr/share/man/man1/pswdb.1.gz -rw-r--r-- root/root 601 2017-09-22 08:37 ./usr/share/man/man1/scanwise.1.gz -rw-r--r-- root/root 584 2017-09-22 08:37 ./usr/share/man/man1/scanwise_server.1.gz +------------------------------------------------------------------------------+ | Post Build | +------------------------------------------------------------------------------+ +------------------------------------------------------------------------------+ | Cleanup | +------------------------------------------------------------------------------+ Purging /<> Not removing build depends: as requested +------------------------------------------------------------------------------+ | Summary | +------------------------------------------------------------------------------+ Build Architecture: ppc64el Build-Space: 224384 Build-Time: 214 Distribution: bionic-proposed Host Architecture: ppc64el Install-Time: 43 Job: wise_2.4.1-20.dsc Machine Architecture: ppc64el Package: wise Package-Time: 259 Source-Version: 2.4.1-20 Space: 224384 Status: successful Version: 2.4.1-20 -------------------------------------------------------------------------------- Finished at 20171101-1720 Build needed 00:04:19, 224384k disc space RUN: /usr/share/launchpad-buildd/slavebin/in-target scan-for-processes --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 Scanning for processes to kill in build PACKAGEBUILD-13664339 RUN: /usr/share/launchpad-buildd/slavebin/in-target umount-chroot --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 Stopping target for build PACKAGEBUILD-13664339 RUN: /usr/share/launchpad-buildd/slavebin/in-target remove-build --backend=chroot --series=bionic --arch=ppc64el PACKAGEBUILD-13664339 Removing build PACKAGEBUILD-13664339